(data stored in ACNUC30630 zone)

EMBL: CP001606.PE361

CP001606.PE361       Location/Qualifiers
FT   CDS_pept        complement(459346..462042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0376"
FT                   /product="glycogen operon protein GlgX"
FT                   /note="COG1523 Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47326"
FT                   /protein_id="ACS47326.1"
FT                   /translation="MQLQKLQRYATRPGFFYTDDGGADVVVRSETAEQLWLSVLEPVDK
FT                   PSAFYNQAVRLPDDAADRLLDYMRHYPICSRIVPALGLRETLFKMTGPNYGLWNLHLDK
FT                   AWDGLQYGFRADGTWDPHHGLRFNPYKFLIDPYAKGIERAMQLDPSMFAYQCTIGDDGK
FT                   VEGDSWGEMSTLDSLGHCPVSVAIDDRDARKHDGDPEHPHVPWSKTVIYELHVKGFTKN
FT                   APWLPEELRGTYAGLAHPTTLAYLQDLGVTSIELLPIMAKQPEVFLQERVRTNYWGYST
FT                   LNFFSPEPGYATKKAQQAGAAAVRREVIDMVRALHESGFEVIMDVVYNHTCEGGNAGPS
FT                   VCWRGLDNLSFYRQQTQHAGELEDTTGCGNTVDFTDTHNITFAVDSLRYWAKRIGIDGF
FT                   RFDLAVSLARLKGMFTPYHPFLYALRSDQLLGNLKLIMEPWDLGFQGWRTGQFLSPFGE
FT                   WNDRFRDASRQFWLSDINQTAGHGVTTMQEMATRLCGSADLFATDPGRGATSSINYISA
FT                   HDGFTLADLTSYDHKHNEANGENNNDGTNVNHSANFGVEGPTDDLSIESARERSRMNML
FT                   GTLILSLGTPMLLAGDEFGNTQYGNNNAYCQDNEIAWLDWDWINCTEETAESRQLEATA
FT                   NLIAVRKSLDIYNHEDFFTRLSQLGLLKPSSRVQWSLPDGTMPMDSDWRDPSVRSFMMH
FT                   LYFKDEPDALIVVNGDETDRRMHLPSDSTFNLLWSSAQTTGEQPAPGTSVTKILRSAAV
FT                   SPLAETLRFKRATSPLHDLDAHGAVGADAEENAARQEIGTTKPTAKLTAHETQLLESIL
FT                   DRKIKDTLDQQMPPMTAGAHSGTGDPTRISMADSDPTTTAFDVEHDAPTPEDTAPAAGS
FT                   PNAVPSNVWTFPALSISLLLQSERRSW"
     atgcagttac agaaattaca gcgatacgcc acgcgaccag gcttcttcta caccgatgac        60
     ggcggcgcgg acgtcgtggt acgttctgag accgcggaac aactgtggtt gagcgtgctc       120
     gagccggtgg acaaaccgag cgcgttctac aaccaggcgg ttcgcctgcc cgatgacgca       180
     gcggacaggc tcctcgacta catgcgccat tacccgatct gctcgcgcat cgtgcctgcg       240
     ctcggcctgc gcgagacatt gttcaagatg accggcccga actatggcct gtggaacctc       300
     catctcgaca aggcatggga cggtctgcaa tacggattcc gcgccgacgg aacatgggac       360
     ccgcatcacg gcctgcggtt caacccgtac aagttcctca tcgaccccta tgccaagggc       420
     attgagcggg cgatgcaact cgacccttcc atgttcgcgt accaatgcac cataggcgac       480
     gacggcaagg tcgaaggaga ctcctggggt gaaatgagca cgctcgattc tctgggccat       540
     tgcccggtgt cggtggcgat cgacgaccgt gacgcccgca agcacgacgg cgacccggaa       600
     cacccgcatg tgccgtggag caaaacggtg atctacgagc tgcatgtgaa gggcttcacg       660
     aagaacgcgc catggttgcc ggaggagcta cgcggtacct acgccggcct cgcccacccc       720
     accacactcg cctatctgca ggatctgggc gtcacatcaa tcgaactgtt gccgatcatg       780
     gccaagcagc ccgaggtgtt cctgcaggaa cgcgtgcgca cgaactactg gggctattcc       840
     acgctcaact tcttctcccc tgagcccggt tatgccacga agaaggctca acaggccggt       900
     gccgccgccg tgcgtcgtga ggtgatcgac atggtacgcg ccctgcatga atccggcttc       960
     gaggtgatca tggacgtggt gtacaaccac acctgcgagg gcggcaatgc cgggccgagc      1020
     gtctgctggc gtgggctcga caatctctcg ttctaccgcc agcagaccca gcatgccggc      1080
     gagctcgaag acaccaccgg ctgcggcaac accgtggact tcaccgacac ccacaacatc      1140
     acattcgccg tggattcgct gcggtactgg gccaagcgca taggcataga cggcttccga      1200
     ttcgacctcg ccgtctcgct ggcgcggctc aagggcatgt tcaccccata ccatccgttc      1260
     ctgtacgcat tgcgttccga ccagctgctc ggcaacctca agctcatcat ggagccgtgg      1320
     gatctgggct tccaagggtg gcgcaccggc cagttcctct cgcccttcgg agagtggaac      1380
     gaccgattcc gcgacgcctc ccgccagttc tggctctccg acatcaacca gactgcgggc      1440
     catggtgtga ccaccatgca ggagatggcc acgcgcctgt gcggttcggc ggacctgttc      1500
     gccaccgacc cgggccgtgg cgccacgtca tcgatcaatt acatcagcgc gcacgacggc      1560
     tttacactgg ccgacctcac cagctacgac cacaagcaca acgaggcgaa tggcgagaac      1620
     aacaacgacg gcacgaacgt gaaccattcc gccaacttcg gcgtggaggg ccccaccgac      1680
     gacctcagca tcgagagcgc acgcgaacgt tcgcgcatga acatgctcgg cacgctcatt      1740
     ctctcgcttg gcacgcccat gctgctcgca ggagacgaat tcggcaacac gcaatacggc      1800
     aacaacaacg cgtattgcca agacaacgag atcgcctggc tcgactggga ttggatcaac      1860
     tgcacagagg aaaccgccga atcccgccaa ctcgaggcca ccgcgaatct gatcgccgtg      1920
     cgcaaatcgc tcgacatata caatcacgag gacttcttca cgaggctctc ccagttgggg      1980
     ctgctcaagc cgagctcgcg tgtgcagtgg agcctgccgg atggcacgat gcccatggat      2040
     tccgattggc gcgacccgtc ggtgcgctcg ttcatgatgc acttgtattt caaggacgaa      2100
     cccgacgcgc tgattgtggt caacggcgat gaaaccgacc gccggatgca cctgccgtcg      2160
     gattcgacgt tcaatctgct atggtcgtcg gcgcagacca ctggcgaaca gcccgcaccg      2220
     ggcacctccg tcaccaagat cttacggtct gcggcggtgt cgccacttgc ggagacgctg      2280
     cggttcaagc gtgcgacgtc gcccctgcac gatctcgacg cccatggtgc cgttggcgcg      2340
     gacgccgagg agaatgccgc ccgtcaggag attggaacca ccaagccaac ggcaaagctc      2400
     accgcacatg agacgcagct cctcgaatcc attctcgacc gcaagatcaa agacacactc      2460
     gaccagcaga tgccgccgat gaccgccggt gcacactccg gaaccggcga ccccacacgc      2520
     atcagcatgg ccgattccga tcccacgacc accgcattcg acgtcgagca cgatgcccct      2580
     acgcccgaag acaccgctcc ggctgcaggt tcccccaatg ccgtcccatc gaacgtgtgg      2640
     accttcccgg cgctgagcat aagcctgctg ctgcaatcgg agcgccgctc ctggtga         2697
//

If you have problems or comments...

PBIL Back to PBIL home page