(data stored in ACNUC30630 zone)

EMBL: CP001606.PE372

CP001606.PE372       Location/Qualifiers
FT   CDS_pept        472039..472341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0387"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47337"
FT                   /protein_id="ACS47337.1"
FT                   /translation="MVDLIRGKKATEAITILKFAPQDASTPVLKVLQSAIANARVKADK
FT                   AGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVASKEGDR"
     atggtcgacc tcatccgagg caagaaagcg accgaagcca tcaccattct caagttcgct        60
     ccgcaggacg ccagcacccc ggtgctcaag gtcctccaga gtgccatcgc gaacgcccgc       120
     gtgaaggccg acaaggccgg cgagccgttc cgtgagaacg acctgtacat caaggagacc       180
     tatgtggacg agggtgtgac gctcaagcgt ttccgcgctc gtgcacaggg ccgtgccgct       240
     cgtatcaaca agcgtacgag ccacatcacg gtcgtcgtcg ctagcaagga aggagaccgc       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page