(data stored in ACNUC30630 zone)

EMBL: CP001606.PE375

CP001606.PE375       Location/Qualifiers
FT   CDS_pept        473604..473852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0390"
FT                   /product="Ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47340"
FT                   /protein_id="ACS47340.1"
FT                   /translation="MPVGSEEYTIKNLNEKTNAEIEGFIKKSKEELFNLRFQHATGQLE
FT                   NTARLKAVKRDIARMYTVLRERELGISQAPAATETKA"
     atgccagtcg gatcggaaga atacaccatc aagaatctca acgagaagac caatgctgag        60
     atcgagggct tcatcaagaa gtccaaggaa gagctgttca acctgcgctt ccagcatgca       120
     accggtcagc tcgagaacac tgctcgcctc aaggctgtca agcgtgacat cgccaggatg       180
     tatactgttc tgcgcgaacg tgaacttggc atcagccagg ctccggcggc aaccgaaacg       240
     aaagcttaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page