(data stored in ACNUC30630 zone)

EMBL: CP001606.PE376

CP001606.PE376       Location/Qualifiers
FT   CDS_pept        473862..474122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0391"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47341"
FT                   /protein_id="ACS47341.1"
FT                   /translation="MAEERNFRKVRRGYVVSDKMDKTISVELELRTTHPLYGKVVRSTR
FT                   TVKAHDENNQAHVGDLVSIMETRPLSKTKRWRLDSIIERAK"
     atggctgaag agcgtaactt ccgcaaagtt cgtcgcggtt atgtcgtgtc cgacaagatg        60
     gacaagacca tttccgtgga actcgaactt cgtacgaccc acccgctcta cggtaaggtc       120
     gttcgttcca ctcgcacggt caaggcccat gacgagaaca accaggctca cgttggcgac       180
     ctcgtgagta tcatggagac tcgtccactg agcaagacca agcgttggcg tctcgattcc       240
     attatcgagc gcgctaagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page