(data stored in ACNUC30630 zone)

EMBL: CP001606.PE377

CP001606.PE377       Location/Qualifiers
FT   CDS_pept        474211..474579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0392"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47342"
FT                   /protein_id="ACS47342.1"
FT                   /translation="MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKERRRADGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMRIVSLAPEVI"
     atgattcagc aggaaacgcg gcttcatgtc gccgacaaca cgggtgcgaa ggaactcctc        60
     gccatccgag tgctcggcgg atcgaagcga cgctatgccg gcatcggcga cgtgatcgtc       120
     gcctccgtca aggacgcaat ccctggcggg tcggtcaaga agggcgacgt ggtcaaggcc       180
     gtcgtcgtcc gtacagtcaa ggaacgccgc cgtgcagacg gctcctacat caagttcgac       240
     gagaacgccg ctgtgattct cggctccggc cgtgaaccca agggcactcg tatcttcgga       300
     ccggttggtc gtgaactgcg cgacaagcgc ttcatgcgta tcgtgtccct cgcaccggag       360
     gtgatctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page