(data stored in ACNUC30630 zone)

EMBL: CP001606.PE407

CP001606.PE407       Location/Qualifiers
FT   CDS_pept        500785..501942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0424"
FT                   /product="hypothetical protein"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47372"
FT                   /protein_id="ACS47372.1"
FT                   /translation="MGDNQWVLILVCMIAAIIVIVGAVVGIRIALHIRRVETIKNERRR
FT                   DAVHYAFVINPSKPTAGETRAFIERFCTNRGIADIMFIETQLDKDGRACALEALEQGAD
FT                   VVIAVGGDGTVRTVASAMGGTNHAMGIIPIGTGNLFARNMNIPVGDLEAAMLIAISHGS
FT                   YKVDIGRLQLLDHPEEDHAHAFLIIAGIGFDAVMIDDTDPKLKKNISWLAYFVAGAKHL
FT                   FAPKYHASVVLTGANGDQHVREDVEFRTFMSGNCGEIPVFSLMPDASFNDGLLDFEVID
FT                   TNGGIIGWMNLFGDVVHQTITRKAQQSPLSVHSTIDQVQGVSAELQLEKPVPAQVDGDM
FT                   LKPTRHIRFSVDHNALIVRAPGQDAEMTGNLQPVRVDASGKPRLR"
     atgggtgaca atcagtgggt gctgattctc gtatgcatga tcgccgctat catcgtgatc        60
     gtgggggccg tcgtcggcat tcgcatcgcg ttgcacatac gtcgtgtgga gacgatcaag       120
     aacgaacgcc gcagggacgc ggtgcattat gccttcgtaa tcaacccgag caagccgacg       180
     gccggcgaga cgcgcgcgtt tattgagcgt ttctgcacga accgtggcat cgccgacatc       240
     atgttcattg aaacgcagct cgacaaggac ggccgcgcct gtgcgctcga agccctcgag       300
     cagggggcgg acgtggtgat tgcggtgggc ggcgatggca ccgtgcgcac ggtcgcgagt       360
     gcgatgggcg gcacgaacca tgccatgggc atcattccga tcggcacggg caatctgttc       420
     gcccgaaaca tgaacattcc ggtgggtgac ctcgaggcgg cgatgctgat tgcgatctcg       480
     catgggtcgt acaaggtcga catcggtcga ctgcagctgc tcgaccaccc ggaagaggat       540
     catgcgcatg ccttcctaat catcgccggc attggcttcg atgcggtgat gatcgacgac       600
     accgacccca agctcaagaa gaacatcagt tggctcgcct acttcgtggc cggtgccaag       660
     catctgttcg cccccaaata ccatgcgagc gtggtgctca ccggcgcgaa cggcgaccag       720
     catgtgcgcg aggatgtcga gttccgcacg ttcatgagcg gcaactgcgg cgagattccg       780
     gtgttctcgc tcatgcccga cgcctcgttc aacgacggtc tgctcgattt cgaggtgatc       840
     gacacgaacg gcggcatcat tggctggatg aatctgttcg gcgacgtggt gcaccagacg       900
     atcacgcgca aggcccagca gagcccgctg tcggtgcatt cgacgatcga ccaggtgcag       960
     ggcgtgagcg ccgaactgca gttggagaag ccggttcccg cgcaggtgga tggcgacatg      1020
     ctgaaaccga cccggcacat ccgtttctcc gtggatcaca atgcgctcat cgtgcgcgcg      1080
     cccgggcagg atgccgagat gaccggcaat ctgcagcccg ttcgtgtgga tgcgagcggc      1140
     aagccaagat tgcggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page