(data stored in ACNUC30630 zone)

EMBL: CP001606.PE409

CP001606.PE409       Location/Qualifiers
FT   CDS_pept        complement(503900..505459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0426"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47374"
FT                   /protein_id="ACS47374.1"
FT                   /translation="MSIVMIALFAGLGIAMEPKWSVKPLSMHLQVTERSTAIKARGITT
FT                   PQEGTYQVRQTRLRLPISGGKTVNAILREPENAPSGRAACVFVHGAGTGKAEEVYADLA
FT                   NALASAGITTLVQDKRLDNYTPLRRDYDSSAEDYLAGLNLLRAQQGVDARKVGLYAESE
FT                   GTWIASVMTHKDRHIAFQVLTSAPVYSGRQQIAMAATEYLNIIGAPGGVVDIIPRLLSL
FT                   NFAPIGLEYADFNTAEYRDTLTMPLLVNYGTIDPAMPIEQGALQLIGDAHAAGNSNVLV
FT                   RYYAANHQMRTGSSLSLPGLPLDKDYTHNLEDWINAIAAGATEDDWLTPDIAGARPYQE
FT                   YAIPENISSGLVSSVWVLVVLIVICLVSWLLTVVFCIGAFVSRKRVEAKTVDDSGHIVV
FT                   HRFTMLSKVLIITNIVLLPICAAGFLGYFAFTAKAALSLTDEATMLSFGWSMLRLGSLV
FT                   LIVMNSWMWVRMFFFYGPGNIDKEYPKTAMRMASGHTATVALLSVSVLCALVLSSFFGL
FT                   IG"
     gtgtccatcg tcatgattgc gctgttcgca ggacttggca tcgcgatgga accgaaatgg        60
     tcggtgaaac cgctcagcat gcatctgcag gttaccgagc gcagcacggc gatcaaagcg       120
     cgcggcatca ccaccccgca ggaaggcacc taccaggtca ggcagactcg tctgcggctg       180
     cccatctccg gcggcaagac ggtgaacgcg attctgcgcg agcccgagaa tgcacccagc       240
     ggccgcgcgg catgcgtgtt cgtgcacggt gcgggcaccg gcaaggcgga ggaggtgtac       300
     gccgatcttg cgaacgcgct ggcctcggcc ggcatcacca cgctcgtgca agacaagcgt       360
     ctcgacaact acacgccgtt gcgccgcgac tatgactcaa gcgccgaaga ctacctcgca       420
     gggctcaatc tgctgcgcgc acagcagggc gtggacgcgc gcaaggtcgg cctgtacgca       480
     gaatcggaag gcacatggat cgcctcggtg atgacgcata aggataggca catcgcattc       540
     caggtgctca cgagcgcgcc cgtgtattcc ggtcgccagc agattgcgat ggcggccact       600
     gaatacctga acatcatcgg cgcgccaggc ggcgtcgtcg acatcatacc gcgcctgctc       660
     agtctcaact tcgcaccgat cggccttgaa tatgccgatt tcaacacagc cgaataccgt       720
     gatacgctca cgatgccgct gctcgtcaac tacggtacga tcgacccggc catgcccatc       780
     gaacagggcg cgctccaact gatcggcgac gcccatgccg ccggcaattc gaacgtgctc       840
     gtgcgctact acgccgccaa ccaccagatg cgcaccggtt cctcgctctc cttgcccgga       900
     ctgccgctcg acaaggacta cacccacaat ctcgaggatt ggatcaacgc gattgccgcc       960
     ggcgcgaccg aggacgattg gctgacgcct gacatcgcgg gggcacgccc ctatcaggaa      1020
     tatgcgatac cggagaacat ctcctccggt ctcgtatcgt cagtctgggt gctcgtggtg      1080
     ctcatcgtga tatgtctcgt ctcgtggctg ctcacggtcg tcttctgcat aggcgcattc      1140
     gtctcacgca aacgggtgga ggcgaagact gttgatgaca gcgggcacat tgtggtgcac      1200
     cgtttcacca tgctttccaa agtgctcatc atcacgaaca tcgttttgct gccgatatgc      1260
     gcggccggtt tcctcggcta tttcgcgttc accgcgaagg ccgcgctctc gctgaccgat      1320
     gaggccacca tgctctcctt cggctggagc atgctgcggt tgggcagcct ggtgctcatt      1380
     gtcatgaaca gctggatgtg ggtgcgcatg ttcttcttct acggccccgg caacatcgac      1440
     aaggaatacc cgaagacggc catgcgcatg gcttccgggc ataccgccac cgtcgccctc      1500
     ctgtcggtga gcgtgctgtg cgcgctggtg ctcagctcgt tcttcggcct cattggctga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page