(data stored in ACNUC30630 zone)

EMBL: CP001606.PE420

CP001606.PE420       Location/Qualifiers
FT   CDS_pept        518305..519366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47385"
FT                   /protein_id="ACS47385.1"
FT                   /translation="MNPNENNGAQPSNDLPPYAQPTPAPQPAQGSPSPQGQQPAYANAQ
FT                   SAPQQPQSVSQTPHDAPQFAQNTPQGAPAGTTTVDMKESVNKFADALGKQHLKIGNHEV
FT                   AYGNLVTVVGALLAIIGVFLPFASISAFGVSMSVSLMPHGDGWILLIGAVVIAVLAVLR
FT                   QEIAALTVTIIYTLLVIYEIAAAGSKISQSGYGTLLQLSYGAGMWLLIIAIIVMLIGTI
FT                   FAFYNKQRAKNAQNGAPAMPVQNPAYDASYQDNGWQFGVPAQSDPSNVDNSQWQFGVEN
FT                   PPADAGVQQGTPVAPAPNAAAPVPPAVAHEPFNAAPDASATPAAPAAPAAPAAPAQPTI
FT                   PPASQDPDSQDAQ"
     atgaatccaa acgagaacaa tggcgcgcag ccgtcgaacg acctgccgcc gtatgcccag        60
     ccgacgccgg ccccgcagcc ggcacagggc tcgccgtccc cccaagggca gcagcctgcg       120
     tatgccaacg cacagtcggc accacaacag ccgcaatccg tgtcgcagac gccgcacgac       180
     gcaccccaat tcgcacagaa caccccgcag ggtgcgccgg ctggcacgac cacagtggat       240
     atgaaggaat cggtgaacaa gttcgcggac gcgctcggca agcagcatct gaagatcggc       300
     aaccatgagg tggcctacgg caatctggtg accgtcgtcg gcgcgctcct tgcgatcatc       360
     ggcgtgttcc tgccgtttgc aagcatcagt gccttcggtg tctctatgtc tgtgtcgctc       420
     atgccacatg gcgatgggtg gatcctgctc atcggcgccg tcgtgatcgc cgtgctcgcc       480
     gtgttgcggc aggagatcgc ggcactgacc gtcacgatca tctacacgct gctcgtcatc       540
     tacgagatcg ccgccgccgg cagcaagatc tcccagtcag ggtacggcac gctcctccaa       600
     ttgagctatg gcgccggcat gtggctgctc atcattgcga tcatcgtcat gctcatcggc       660
     accatcttcg cgttctacaa caaacagcgt gccaagaacg cccagaatgg tgcgccggcg       720
     atgcctgtgc agaatccggc atacgacgct tcgtaccagg acaacggctg gcagttcggc       780
     gttcccgccc agagtgatcc gagcaatgtc gacaatagcc agtggcagtt cggtgtcgag       840
     aatccgcccg ccgatgcggg cgtacaacaa ggcacgcctg tggcaccggc cccgaatgcg       900
     gctgcaccgg ttccgccggc agtggcccat gagccattca atgctgcgcc ggacgcctct       960
     gcaactccgg cggcacccgc tgcaccggca gcgcctgccg cgccggctca acccaccatt      1020
     cctcccgcat cgcaagatcc ggattcacag gacgcgcagt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page