(data stored in ACNUC30630 zone)

EMBL: CP001606.PE429

CP001606.PE429       Location/Qualifiers
FT   CDS_pept        531277..533403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0447"
FT                   /product="myosin-crossreactive antigen"
FT                   /note="COG4716 Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47394"
FT                   /protein_id="ACS47394.1"
FT                   /translation="MYYSAGNFEAFAHPKKPEGLENKSAYIIGTGLAALTAAFYLVRDA
FT                   QMPGKNIHVFDKDVVPGGALDGAFIKGEGYVMRGGREMDNHFEVMWDVYRDVPSIEDPN
FT                   VSMLDHYYWLNKEDPNYSKCRATKARGHNAHTDNKFNLSDKGCMEILKLYLASEDELAN
FT                   KKITDYFDDEVLNSNFWLYWRTMFAFENWDSALEMHRYIHRFIHHIGGLPDFSALRFTR
FT                   YNQYESMILPLMNYLKAHDVQFHMGTAVDDVTFAISDHENGPVRNVFTNVSMDEAQRAQ
FT                   AENGAFPRNPYSTPNKKVAKTLVITDLVKNERKTIELTEDDFVFITNGGLVESTTEGDQ
FT                   NTPAGFDPTLKPGNGWDMWNRIAAVDPSFGHPEKFIYDPNLTKWMSATATTLDDTIPAY
FT                   IEKITGRSPFGGHTVTGGIVTVEDSNWLMSWTVNRQQQFRNQPKDMISAWIYGLFPDKP
FT                   GNYIRKPMQDCTGMEICEEWLYHMGVPEEQIEELAKNHCNTVPVMMPYVDAFFMPRELG
FT                   DRPDVVPDGAVNFAFIGQFAEEPRDTIFTTEYSMRTGMEAVYTLCDVDRGVPEVWNSEY
FT                   DVRDMLNAAVKLRDGQPLTTFGRNNVERKAIAFALGRTRGTYIYDMLKVYGAIADPKHP
FT                   VDMKPGMRFDESFNEADEQRLMQHAKEAEAEAFATPCSADAPVAADTVDTVDTVAPAAA
FT                   PDGALEPGENDSAK"
     atgtactatt cggcaggcaa tttcgaagcg ttcgcacacc cgaagaagcc ggaaggcctc        60
     gagaacaaga gcgcgtacat catcggcacg ggactggcgg cgctcaccgc tgcgttctat       120
     ctcgtgcgcg atgcgcagat gccgggcaag aacatccacg tgttcgacaa ggacgtggtt       180
     cccggcggtg cgctcgatgg cgcgttcatc aagggcgagg gctacgtcat gcgcggtggc       240
     cgcgaaatgg acaatcattt cgaggtcatg tgggacgtct accgcgatgt gccgagcatc       300
     gaagacccga atgtgtcgat gctcgaccac tactactggc tcaacaagga ggacccgaac       360
     tattcgaagt gccgcgccac caaggcacgt ggccacaatg cgcacaccga caacaagttc       420
     aatctctccg acaaggggtg catggagatc ctcaagctct acctcgcctc cgaggacgag       480
     ctcgccaaca agaagatcac cgactacttc gacgacgaag tgctcaattc gaatttctgg       540
     ctgtactggc gcaccatgtt cgccttcgag aactgggatt ccgcgctcga gatgcatcgc       600
     tacatccacc ggttcatcca tcacatcggt ggcctgcccg acttctcggc attgcggttc       660
     acgcgataca accagtatga gtcgatgatc ctgccgctca tgaactacct caaggcgcac       720
     gacgtgcagt tccacatggg caccgccgtc gacgacgtca ccttcgccat cagcgaccac       780
     gagaacggcc cggtccgcaa tgtgttcacc aatgtgtcga tggacgaggc ccaacgcgcc       840
     caagcagaga acggcgcatt cccgcgcaac ccgtacagca cgccgaacaa gaaggtcgcc       900
     aagacgctgg taatcaccga cctggtgaag aacgagcgca agacgatcga actcaccgag       960
     gacgatttcg tgttcatcac caacggcggc ttggtggagt cgaccaccga gggcgaccag      1020
     aacacgccgg ccggcttcga tccgacgctc aagccgggca acggctggga catgtggaac      1080
     cgcattgccg ccgtcgaccc gagcttcggc cacccggaga agttcattta cgatccgaac      1140
     ctcaccaagt ggatgagcgc caccgctacc acgcttgacg acacgattcc ggcctacatc      1200
     gagaagatca ccggacgctc gccgttcggc ggtcacaccg ttaccggcgg catcgtgacc      1260
     gtggaggatt cgaactggct gatgagctgg accgtgaacc ggcagcagca gttccgcaac      1320
     cagccgaagg acatgatctc ggcgtggatc tacggtttgt tccccgacaa gccgggcaac      1380
     tacattcgca agccgatgca ggactgcacc ggtatggaga tctgcgagga atggctctac      1440
     cacatgggag tgcccgaaga acagatcgag gagctcgcga agaaccattg caacacggtg      1500
     ccggtcatga tgccgtatgt cgacgcgttc ttcatgccgc gcgaactcgg tgaccgcccc      1560
     gacgtcgtgc cggacggtgc cgtcaacttc gcgttcatcg gccagttcgc cgaggagcca      1620
     cgtgacacga tcttcaccac ggaatattcg atgcgcaccg gcatggaggc cgtgtacacg      1680
     ttgtgcgatg tggatcgtgg cgtgcctgag gtgtggaaca gcgaatacga cgtgcgtgac      1740
     atgctcaacg cggccgtcaa gctgcgcgat ggacagccgc tcaccacctt cggacgcaat      1800
     aatgtggaac gcaaggcgat tgcatttgcg ctggggcgca ccaggggcac gtacatctac      1860
     gacatgctca aggtgtatgg cgccatcgcc gacccgaagc acccggtgga tatgaagccg      1920
     ggcatgcggt tcgacgagtc gttcaatgaa gcggatgagc agcgtctgat gcagcatgcc      1980
     aaggaggcgg aggccgaggc gttcgcgacg ccgtgttccg ccgatgcacc ggttgccgcc      2040
     gacaccgtgg acaccgtgga caccgtcgcc ccggcggctg cgcccgacgg cgctctcgag      2100
     ccgggggaga atgattcggc gaaatga                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page