(data stored in ACNUC30630 zone)

EMBL: CP001606.PE460

CP001606.PE460       Location/Qualifiers
FT   CDS_pept        complement(572431..572826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47425"
FT                   /protein_id="ACS47425.1"
FT                   /translation="MAEDKTSDELTERDIEDLNDPDDNPDVADADATEHNLRRAVIICF
FT                   IVTSVMCLCINIVVLLMLQRKGKLDKAAANLDEFKENMQHLASDKSRQIARNKDVRKAM
FT                   DTISQHIREIPSEAQSAVTRVRDSLAK"
     atggcagaag acaagaccag tgatgagctg accgaacgcg acatcgagga tctcaacgat        60
     ccagacgaca atccggatgt ggctgatgcg gatgcaacgg aacataatct gcggcgtgcg       120
     gtgatcatct gcttcatcgt gacgagcgtg atgtgcctgt gcatcaatat cgtggtgctt       180
     ctgatgctgc agcgcaaggg caaactcgac aaggcggccg ccaatctcga cgagttcaag       240
     gagaacatgc agcatctggc cagcgacaag agccgccaga tcgcccggaa caaggacgtg       300
     cgcaaggcaa tggacacgat ttcgcagcat attcgcgaga ttccaagcga ggcgcagagc       360
     gcggtgaccc gcgtacgcga ttccctcgca aagtag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page