(data stored in ACNUC30630 zone)

EMBL: CP001606.PE461

CP001606.PE461       Location/Qualifiers
FT   CDS_pept        572973..573563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47426"
FT                   /protein_id="ACS47426.1"
FT                   /translation="MRLCRAFLQYALHMTANDTLGSPYSSPDPNEHGDNPYVGDPGYSQ
FT                   VPQQAYTAQYATPQPNYTQQYPPQGAYGYPMAPVDQWNGMCIAGFICSFFFPLVGLVLS
FT                   IIALVQINKTGEKSRGMAIAGIVIGGISTALALIAIIMVICGLAIGLGALAETGWDDYE
FT                   YHYDTHSDYSQFDEVGADYLAHIRSVDQLMKTA"
     atgcgcctat gccgtgcgtt cttgcagtat gctttgcata tgactgcaaa cgataccctc        60
     ggctcaccgt actcgtctcc ggaccccaat gagcatggcg acaatccgta cgtcggagac       120
     cccggctact cacaggtccc tcagcaggca tacacggcac agtatgcgac tccgcagcca       180
     aactacacgc agcagtatcc tccacagggt gcctacggtt atcccatggc tccggtggac       240
     cagtggaacg gcatgtgcat tgccggtttc atctgctcgt tcttcttccc gctcgttggc       300
     ctcgtgcttt cgatcatcgc gctcgtgcag atcaataaaa ccggcgagaa gagccgaggc       360
     atggccatcg ccggcattgt gatcggcggc atctcgacgg cgctcgctct cattgcgatc       420
     atcatggtca tctgcggatt ggcgattggg ctcggcgcgc tcgccgaaac aggatgggac       480
     gattacgagt accactacga tacacacagt gactactcgc agttcgacga ggtgggtgca       540
     gattaccttg cgcatatacg ctctgtggac cagctcatga aaacggcatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page