(data stored in ACNUC30630 zone)

EMBL: CP001606.PE482

CP001606.PE482       Location/Qualifiers
FT   CDS_pept        598709..599137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0504"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47447"
FT                   /protein_id="ACS47447.1"
FT                   /translation="MQRTIVTDTSFLSRPSDPADPADPLDAAIAQDLKETLAAHREECV
FT                   GMAANMIGEPKRVIAFVDEGLGSAITVMFNPQITAADGEYDACEGCLSLHGERHTPRFR
FT                   RIEVDYTTRKGRARHATFTDWTAQIIQHEIDHCNGVLI"
     atgcagcgaa cgattgtcac cgataccagc tttctctcac gtcccagcga ccccgccgac        60
     ccagccgacc cgctcgacgc cgccattgcg caggatctga aggagacgct cgccgcgcac       120
     cgcgaagaat gcgtgggcat ggcggcgaac atgataggcg agccgaagcg cgtgatcgcc       180
     ttcgtcgacg aaggcctggg cagcgcgatc actgtcatgt tcaacccgca gatcactgcc       240
     gccgacggtg aatacgacgc ctgtgaaggc tgcctctcgc tgcatggcga gcgccacaca       300
     ccacgtttcc gccgcatcga ggtcgattac acgacacgca agggacgcgc tcgccacgcc       360
     accttcaccg actggaccgc gcagatcatc cagcacgaga tcgatcactg caacggcgtg       420
     ctcatctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page