(data stored in ACNUC30630 zone)

EMBL: CP001606.PE486

CP001606.PE486       Location/Qualifiers
FT   CDS_pept        complement(602803..603651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47451"
FT                   /protein_id="ACS47451.1"
FT                   /translation="MYGIDADSFLRCAHSYGMNWGDRTLNVIEKGQATAGIRLTLVILC
FT                   VLNQISDAKLRLADILDFTDPADSIRITPDISTPSRTLQRILRGRPVWFYGSPERPGNV
FT                   DRAQREHEVRRSRDADNLTPPPPTCTEEQAMARLDVDLQTLRGWCNALFGMSLDETAHM
FT                   RAQASADSTPELEAHAIVEEIYQDHVRKVKYSMRNCTTWSNSSINLMPTDELDRLEDDL
FT                   SQMEDCLMKFMALRHISFVRDKRAYDADPRNTGPYAFQPDSDIWVDIDEPEDGTLGAEE
FT                   S"
     ttgtatggca tcgacgccga ttcgttcctg agatgcgcgc actcatacgg catgaattgg        60
     ggcgaccgca cgctcaatgt gattgaaaag ggccaggcga ctgcgggcat tcgtctcacg       120
     ctcgtcatat tgtgcgtgct gaaccagatc agcgacgcca aactcaggct cgccgacatt       180
     ctcgatttca ccgacccagc cgattccatt cgcatcacac ccgacatctc caccccttcg       240
     cgcacccttc agcgcattct gcgcggacga cccgtatggt tctatggctc gccggagcgc       300
     cccggcaacg tggatcgcgc acaacgtgag cacgaggtac gccgttcgcg cgatgccgac       360
     aatctgacgc cccctccacc tacctgcacc gaggagcagg caatggcacg gcttgacgtg       420
     gatctgcaga ccctacgcgg ttggtgcaat gcgctgttcg gcatgtcgct cgacgaaacc       480
     gcacatatgc gagcgcaggc ttccgcggac tcgacgcccg agctcgaggc gcacgcgatc       540
     gtggaggaaa tctaccagga ccatgtacgc aaagtgaagt attcgatgcg caactgcacg       600
     acatggagca attcgagtat caatctcatg ccgaccgacg aactcgaccg cttggaggac       660
     gatctttccc aaatggagga ttgcctcatg aaattcatgg cattgcgcca catctccttc       720
     gtgcgcgaca agcgtgccta cgacgccgac ccgcggaata cgggccccta tgcgttccaa       780
     ccagattcgg atatctgggt tgacatcgat gagccggagg atggcacact aggtgccgag       840
     gagtcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page