(data stored in ACNUC30630 zone)

EMBL: CP001606.PE493

CP001606.PE493       Location/Qualifiers
FT   CDS_pept        611809..612678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0516"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47458"
FT                   /protein_id="ACS47458.1"
FT                   /translation="MSAATAYSKNNGFHKSSKTPWGNPVVYFFSLVLVAICVVPVLYII
FT                   FGGFRTNAQITNNPAGLPNPWVISNYKEVITSDIFWTELVNSLIVGICTMVGVVVLGIM
FT                   VSYVIARYRFRYSALMYALFSAGLMFPMTVGITPLYLMIRNLGLSNSLAGIILPQIAFG
FT                   LPQTIIILVPFLQSIPMELEEACLLDGCSRLGFFWRMVIPLSMPGVATTGILTFVGSWN
FT                   GYMLPLFVLSDESKYTLPLGVQMFSSQHSVDTARVLAFTSLAMLPALICFTIFQKKIVG
FT                   GLTGAVKG"
     atgagtgctg caacggcata ttccaagaac aacggtttcc ataagtcatc gaagacccca        60
     tggggcaatc cggtggtcta tttcttctcg ctcgtgctcg tggcgatttg cgtcgtcccg       120
     gtgctctaca tcatcttcgg cggattccgc accaacgcgc agatcaccaa caaccctgcc       180
     ggtctgccga atccctgggt gatcagcaac tacaaggaag tcatcaccag tgacatcttc       240
     tggaccgagc tggtcaactc actgatcgtg ggcatctgca cgatggtcgg cgtcgtcgtc       300
     ctcggcatca tggtcagcta cgtcatcgcc cgctacaggt tccggtactc ggcactgatg       360
     tatgcgctgt tctcagcggg cctcatgttc ccgatgaccg tcggcatcac tccgctgtac       420
     ctgatgatca ggaacctggg cctgtcgaac tccctcgcgg gcatcatcct gccacagatc       480
     gcattcggtc tgccgcagac catcatcatc ctggtcccat tcctgcaatc cataccgatg       540
     gagttggagg aggcgtgcct gctggacggt tgctctcgcc tcggcttctt ctggcgcatg       600
     gtcatcccgc tttcgatgcc cggcgtcgcc acgaccggca tcctcacctt cgtgggaagc       660
     tggaacggct atatgcttcc gctcttcgtc ctgagcgatg aaagcaagta cacgcttccg       720
     cttggtgtgc agatgttcag ctcccagcac tcggtggata cggccagggt cctggcgttc       780
     acctcgctcg ccatgcttcc ggccctcatc tgcttcacga tcttccagaa gaagatcgtg       840
     ggtggcctga ccggcgcggt caagggctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page