(data stored in ACNUC30630 zone)

EMBL: CP001606.PE511

CP001606.PE511       Location/Qualifiers
FT   CDS_pept        634788..635510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0534"
FT                   /product="hypothetical protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47476"
FT                   /protein_id="ACS47476.1"
FT                   /translation="MALQQGAVTITGYLGADPQQYGRNPSRPACTFRLGSTRRYQDRNG
FT                   VWQQLPTTWLTVKAFRGLAANIMQSLHRGDPAIVTGLLNTEQWRDEQGVDHSRLVLEAS
FT                   NVGLDLNYVVTMSMRTPREGYTGQQAPSQMASDEQGSPMRPQTQQATSAAPQSTLSRSS
FT                   MAPGDDGGNPVDPFNQMPPDCLSPDAAASMPQQGDQRDAALEPLVGNGMPPQDLEHGCA
FT                   TDTTNSRKEVRPEDQDEF"
     atggcattac aacaaggagc ggtcacgatc acggggtatc ttggcgcaga tccccaacag        60
     tatggcagga atccgagtcg ccctgcatgc acgttccgac tgggatccac acgccggtat       120
     caggatcgta atggcgtatg gcagcaactg ccgaccacat ggctcaccgt caaagccttt       180
     cgtggcctag cggccaacat catgcaatcg ctgcatagag gcgacccggc catagtcacc       240
     ggattgctca acaccgagca atggcgcgac gagcagggtg tggatcattc acgtctggtg       300
     ctcgaggcga gcaacgtcgg tttggacctg aactacgtgg tcacgatgtc gatgcgcacg       360
     ccgcgggaag ggtacaccgg acagcaggct ccctcacaga tggcatctga cgagcagggt       420
     tcccccatgc gtccacagac ccagcaggct acgtcggcag ctcctcaatc aaccctgtca       480
     cgctcctcta tggcaccggg cgatgacggc ggcaatcccg tggatccctt caaccagatg       540
     ccgccggatt gcctgtctcc cgatgccgct gcgagcatgc cacagcaagg ggatcaacgg       600
     gatgcggccc tggagccatt ggtaggcaac gggatgccgc cgcaggattt ggaacacggt       660
     tgcgcaaccg acacgacgaa ctcgcgaaag gaggtgaggc ctgaggatca agacgaattc       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page