(data stored in ACNUC30630 zone)

EMBL: CP001606.PE513

CP001606.PE513       Location/Qualifiers
FT   CDS_pept        637930..638550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0536"
FT                   /product="hypothetical protein"
FT                   /note="COG3247 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47478"
FT                   /protein_id="ACS47478.1"
FT                   /translation="MSEPNPQYQNQQYNQSPFRLFEGMLPTGAKNLVRGTYGVIGVAAL
FT                   ALGICLLVWPGITLKVAAIVLGIYFLISGVVRIVSSLVEMGLPAGWRILGVLIGIILVI
FT                   GGIVIFKNVTMSTAMLAIMFTLIVGICWIMEGVMALAESWSVPSSGWAIAYAIISIIAG
FT                   FVLLCMPMASTLWLIIFGGCAMVVMGICAIVRAFTFGRVKKNN"
     atgtcggaac cgaatccgca atatcaaaac cagcaataca accaaagccc attccgactg        60
     ttcgagggaa tgctgccgac cggcgcgaag aacctcgtgc gcggcacata cggcgtcatc       120
     ggcgtcgccg cgctcgcatt gggcatctgc ctgctcgtgt ggccgggcat cacgctcaag       180
     gtggccgcca tcgtgcttgg catctacttc ctcatttcgg gcgtcgtgcg catcgtcagc       240
     tcgctcgttg aaatgggact gcccgccggc tggaggatcc tcggcgtgct catcggcatc       300
     atcctcgtga tcggcggcat cgtcatcttc aagaacgtca cgatgtccac cgccatgctc       360
     gccatcatgt tcacgctcat cgtgggcatc tgctggatca tggagggcgt gatggcactt       420
     gccgaatcgt ggagcgtgcc gagctcgggc tgggcgatcg cctacgcgat catctcgatc       480
     atcgccggct tcgtgctgct gtgcatgccg atggcgtcca cgctgtggct gatcatcttc       540
     ggcggctgcg ccatggtggt catgggcatc tgcgcgattg tgcgtgcctt caccttcggc       600
     cgcgtgaaga agaacaactg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page