(data stored in ACNUC30630 zone)

EMBL: CP001606.PE528

CP001606.PE528       Location/Qualifiers
FT   CDS_pept        652755..653609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0551"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47493"
FT                   /protein_id="ACS47493.1"
FT                   /translation="MSEATRKTKSNSDESTATQTPKASVATDIAAAIPAVEAKQVHKAF
FT                   GDLHVLKGIDLTVEPGTVTVILGPSGSGKSTFLRLINQLETITGGEIDVDGEMIGYKKL
FT                   PNGELQTLNDKEIARQRAKLGMVFQKFNLFPHMTALENVMEAPVHVLHMPKAEARKLAI
FT                   KELERVGLGERLDYYPAQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLN
FT                   VMRSLANDGMTMIVVTHEIGFAKEVADQIVFMDGGVVVERGTPDIIDHPKEERFQDFLQ
FT                   HVL"
     atgagcgaag cgacgagaaa aaccaagtcg aacagcgacg aatccactgc aacgcaaacc        60
     ccgaaagcca gcgtggccac cgacatcgcc gccgcgattc cagccgtgga ggccaagcag       120
     gtgcacaagg catttggcga tttgcacgtg ctcaagggca tcgatctgac cgtcgagccg       180
     ggcaccgtca ctgtgattct cgggccgtcc ggttcgggca aatccacatt tctgcgtctc       240
     atcaaccagc tggagacgat caccggcggc gagatcgacg tcgatggcga gatgatcggg       300
     tacaagaaac tgccgaacgg tgaattgcag acgctgaacg acaaggagat cgcccgccag       360
     cgcgccaagc tgggcatggt gttccagaag ttcaatctgt tcccgcatat gaccgcgctt       420
     gaaaacgtga tggaggcacc ggtgcacgtg ctgcacatgc cgaaggcgga ggcacgcaag       480
     cttgccatca aggaacttga gcgcgttgga ctcggcgaac gtctcgacta ctacccggcc       540
     cagctttccg gcggtcagca gcagcgagtg gcgattgcgc gcgcgctcgc catgaagccg       600
     gagatcatgc tgttcgacga gcccacgtcg gcactcgacc ccgagctcgt cggtgaggtg       660
     ctcaatgtga tgcgctcgct cgcgaacgac ggcatgacga tgatcgtggt cacgcatgag       720
     atcggcttcg ctaaggaggt cgccgaccag attgtgttca tggacggggg agtcgtggtg       780
     gaacgcggca cgccggacat catcgatcat cccaaggagg agcgtttcca ggacttcctg       840
     cagcacgtgc tgtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page