(data stored in ACNUC30630 zone)

EMBL: CP001606.PE534

CP001606.PE534       Location/Qualifiers
FT   CDS_pept        complement(660556..661314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0557"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47499"
FT                   /protein_id="ACS47499.1"
FT                   /translation="MILAVDIGNTNIVIGLMEGTETVDTYRITTRSNHTSDEYGLMILQ
FT                   FLQLSNSSPDDVQDAIISSVVPKVMHSFISSMIKFLGIDPMIIGPGIKTGMNIRMDDPR
FT                   SLGADLLADCAGAYTTYGGPVLVIDMGTATTYNYVDEKGAILAGLITTGIGTAAAALAS
FT                   NTAQLPEVQITRPKSILAANTKDAMQAGLYYDCLGGIERTITQFREELDTDFKVVATGG
FT                   MSRIFDCPLIDIVDPTLIFKGMASIYAKNV"
     atgattctgg cagtcgacat cggcaacacg aacattgtga tcggtctcat ggagggcacc        60
     gagaccgttg acacctaccg catcaccaca cggtcgaacc acacgtccga cgaatacggc       120
     ctcatgatcc tccaattcct gcaactgagc aattcctcgc ccgacgacgt gcaggacgcg       180
     atcatctcct ccgttgtgcc gaaagtgatg cattcgttca tctcctcgat gatcaaattc       240
     ctgggcatcg acccaatgat catcggtccg ggcatcaaaa ccggcatgaa cattcgcatg       300
     gacgacccac gctccctcgg cgccgacctg ctcgccgact gtgcaggtgc ctacaccacc       360
     tatggcggcc cggtgctggt catagacatg ggcactgcca ccacctacaa ctacgtcgac       420
     gagaagggcg ccattctcgc aggactcatc accaccggca tcggcaccgc ggctgcagcg       480
     ctcgcctcga acaccgccca gctgcccgaa gtgcagatca cacgacccaa atcgattctc       540
     gccgccaaca cgaaagacgc catgcaggcc ggactctact acgactgcct aggtggcatc       600
     gaacgcacga tcacacagtt ccgcgaggag ctcgacaccg atttcaaggt ggtcgccacc       660
     ggtggcatgt cgcgcatctt cgactgcccg ctcatcgaca tcgtcgaccc gacgctcatc       720
     ttcaaaggca tggcctcgat ctacgcgaag aatgtgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page