(data stored in ACNUC30630 zone)

EMBL: CP001606.PE58

CP001606.PE58        Location/Qualifiers
FT   CDS_pept        complement(64069..64296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47023"
FT                   /protein_id="ACS47023.1"
FT                   /translation="MNINSTARARLYALTAVACAIWLFQNCVEANASGDLLSWSNIILS
FT                   ICLIIVTGYCAVNAVLGWNTKSADTEDPSK"
     atgaacatca attccaccgc acgagcccgc ctctacgccc tcaccgccgt ggcctgcgcc        60
     atctggctct tccagaactg cgtggaggcc aatgccagtg gagatctcct cagctggtcg       120
     aacatcatcc tcagcatctg cctcatcatc gtcaccgggt actgcgcagt caatgcggtg       180
     ctcggctgga acacgaaatc cgcagacacc gaagacccct ccaagtag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page