(data stored in ACNUC30630 zone)

EMBL: CP001606.PE586

CP001606.PE586       Location/Qualifiers
FT   CDS_pept        complement(717421..721155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0610"
FT                   /product="hypothetical protein"
FT                   /note="COG0046 Phosphoribosylformylglycinamidine (FGAM
FT                   synthase, synthetase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47551"
FT                   /protein_id="ACS47551.1"
FT                   /translation="MVFRVHVEKKPGFDVEAQQLTNELRTILGIESLNNVRIINRYDVE
FT                   GISEELFGQTIPTVFSEPQVDNVSIELPDVSGDTVFAVESLPGQFDQRADSASECIQLI
FT                   SQGERPTVRSARVYVLDGQLGDDDLAAIKKYVINPVETREAGLETRETLATYAPTPQPV
FT                   EVLDGFREMDDAQLAEFIADRGLAMDEADLRFVREYFQGEQRDPTITEIKVIDTYWSDH
FT                   CRHTTFGTELDSVEIDDAVVKAAFDKYMAMRHELGRDEKPVCLMDMGTIGAKWLKKNGV
FT                   LTGLDESEEINACTVKVKVDVNGESEDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRD
FT                   PLSGRSYVYQAMRVTGAADPRVPISETLEGKLPQRKLVTTAAHGYSSYGNQIGLATGQV
FT                   NEIYHPGYVAKRMEIGAVVGATPASHVRRETPAPGDKIILLGGRTGRDGIGGATGSSKA
FT                   HNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGEIADGL
FT                   HVDLNQVPKKYDGLDGTELAISESQERMAVDVAAEDVDEFLKYAAEENLEAVVIATVTE
FT                   DPRMVMEWNGEPIVDLSREFLASNGAAKHQDAHVPQQGSYRAPFSSGSLSERMNEMLSD
FT                   INIASNKGLSERFDSTIGAATVLMPFGGKEQLTPAEAMVAKFPVFGETTTASAMAWGFN
FT                   PFLMERNQYTGAYMSVVESLAKLVAAGFEHEKAYLTFQEYFEKLRDEPERWGKPLAAVL
FT                   GALMAQVDLGVGAIGGKDSMSGSFEDLDVPPTLVSFAVAVGDMNRATSPEFKHPGDRVV
FT                   RIAPRYLADGITPDKDALLEVFSTIENLVTDGDALAISTPAYGGTAEALFKMCVGNRIG
FT                   VALDDSIAVDDLFAPAYGSFIVELAPSANMPTVSNLVEIGPIGETTADYVFHAAGETLD
FT                   LANLQEVWENGIASVFPYRSGETDAEAEAVDAISFETMEPTVYKGAKIAKPRVIIPVFP
FT                   GNNCEYDTAAAFERAGAEAQTLIVNNLTPSAVAESTQALVDAIHNSQIIMIPGGFSGGD
FT                   EPDGSAKFITAFFRAPAVTEAVRDLLNNRDGLMLGICNGFQALIKLGLVPFGDIVPMTA
FT                   ECPTLTFNTIGRHQSRLVRTRVASNLSPWLAKTEVGDMHTIAISHGEGRFVASDGMLDQ
FT                   LIANGQVATQYVDEHGVPSMDLSVNPNGSMLAIEGITSPDGRVFGKMGHSERTGDGLYR
FT                   NVPGNIYQPIFEAGVEYFG"
     gtggtttttc gcgtccatgt agagaagaag cccggattcg acgtcgaggc gcagcagctg        60
     acgaacgaat tgcgcacgat tctcggcatt gaatctttga acaacgtccg catcatcaac       120
     cggtatgacg tcgagggaat cagcgaggag ctgttcggcc agacgatccc caccgtattc       180
     agcgagccgc aggtggacaa tgtgagcatc gaactgccgg atgtctccgg tgacacggtg       240
     tttgcggtgg aatcgctgcc cggccaattc gaccagcgcg cggattccgc aagcgaatgc       300
     atccagctca tcagccaggg cgaacgaccg accgtgcgct cggcccgcgt gtatgtgctc       360
     gatggccagt tgggcgacga cgacctcgcc gcgatcaaaa agtacgtgat caatccggtg       420
     gagacccgcg aagccgggct ggagacccga gagacgctcg ccacctatgc ccccaccccc       480
     cagccggtcg aagtgctcga tggcttccgc gaaatggacg atgcacagct tgccgagttc       540
     atcgccgatc ggggcctggc aatggacgag gccgatctga ggttcgtacg cgagtatttc       600
     cagggtgagc aacgagatcc caccatcacc gagatcaagg tgatcgacac gtattggtcc       660
     gaccactgcc gccacaccac tttcggcacc gagctcgact ccgttgaaat cgacgacgcc       720
     gtggtgaagg ccgccttcga caagtacatg gcgatgcgcc atgagctcgg ccgcgacgag       780
     aaacccgtgt gcctcatgga catgggcacg atcggtgcga agtggctcaa gaagaacggc       840
     gtgctcaccg gcctcgacga atcggaggag atcaatgcct gcaccgtcaa ggtgaaggtc       900
     gatgtgaatg gcgagagcga agactggctc ttcctgttca agaacgagac ccataaccac       960
     cccaccgaga tcgagccctt cggtggcgcg gcaacctgca tcggcggctg cattcgcgac      1020
     ccgctttcgg gacgctccta cgtgtatcag gcgatgcgcg tgaccggtgc cgcggacccc      1080
     cgcgtgccga tcagcgagac gctggaaggc aagctgcccc agcgcaagct cgtcaccacc      1140
     gcggcgcacg gctactcctc gtacggcaac cagatcggct tggccaccgg tcaggtcaat      1200
     gagatctacc acccgggcta tgtggccaag cgtatggaga tcggcgccgt tgtgggcgcc      1260
     acgccggcaa gccatgtacg tcgcgagacc ccggcccccg gcgacaagat cattctgctt      1320
     ggcggccgta ccggccgtga tggcattggc ggcgccaccg gttcgtccaa ggcacacaac      1380
     gttgagtcgc ttgaactcga tggagccgag gtgcagaagg gcaacgcccc agtggagcgc      1440
     aagctgcagc gtctgttccg ccgcggtgat gcctgccgct tgatcaagcg atgcaacgat      1500
     ttcggcgcgg gtggcgtgtc cgttgccgtc ggagagatag ccgacggcct gcacgttgac      1560
     ctcaatcagg tacccaagaa atacgacggc ctcgacggca ccgagcttgc catctccgag      1620
     tcgcaggagc gcatggcggt cgatgtggct gcggaagacg tcgacgagtt cctgaagtat      1680
     gccgccgagg agaacctcga agccgtggtc attgcgaccg tgaccgaaga ccctcgcatg      1740
     gtgatggaat ggaacggcga gccgatcgtc gatctctcgc gtgagttcct cgcttcgaac      1800
     ggcgccgcca agcatcagga tgcccacgtg ccccagcagg gctcctaccg tgccccattc      1860
     tcgtccggct cactcagtga gcgtatgaac gagatgctct ccgacatcaa catcgcctcc      1920
     aacaagggcc tgtcggaacg cttcgactcc acgatcggag ccgccaccgt gctcatgccg      1980
     ttcggcggca aggaacagct gacgccggcg gaagccatgg tggccaagtt cccggtgttc      2040
     ggcgagacca ccaccgcctc ggccatggcg tggggcttca accccttcct catggaacgc      2100
     aaccagtaca cgggcgccta catgtcggtg gtcgaatcgc ttgcgaaact cgtggcggcg      2160
     ggcttcgaac acgaaaaggc atacctcacc ttccaggagt atttcgagaa gctgcgcgac      2220
     gagccagagc gctggggcaa accgcttgcg gccgtgctcg gcgccctcat ggcgcaggtg      2280
     gacctcgggg tcggcgccat tggaggcaag gattccatgt ccggctcctt cgaagacctc      2340
     gatgtgcctc ccaccctcgt ctccttcgcc gtggcggtcg gcgacatgaa ccgtgccacg      2400
     tcgccggagt tcaagcaccc cggcgaccgt gtggtccgca tcgcgccacg ctatctggcg      2460
     gacggtatca caccggacaa ggacgcactg ctcgaggtgt tctccaccat cgagaacctg      2520
     gtgaccgacg gcgatgcgct ggccatctcc accccggctt acggcggcac cgcagaagcg      2580
     ttgttcaaga tgtgcgtggg caaccgcatc ggcgtggcgc tcgacgactc catcgccgtc      2640
     gacgatctgt tcgcaccggc gtatggctcg ttcatcgtcg agctcgcgcc atccgcgaac      2700
     atgccgacag tctccaatct ggtcgagatc gggccgatcg gcgagaccac cgcggactac      2760
     gtgttccacg cagccggcga gacgctcgac ctcgcgaatc tgcaggaggt gtgggagaac      2820
     ggcattgcat cggtgttccc ctaccgcagc ggtgaaaccg atgccgaagc cgaggcggtc      2880
     gacgcgatct cgttcgagac gatggaaccg accgtgtaca agggtgcgaa aatcgccaag      2940
     ccgcgcgtga tcatcccggt gttccccggc aacaactgcg aatacgacac cgcggcagcg      3000
     ttcgaacgcg ccggggccga ggcgcagacg ctcattgtaa acaatctgac gccctcagct      3060
     gtcgccgagt ccacgcaggc gctcgtcgac gccatccata acagccagat catcatgatc      3120
     cccggcggtt tctcaggcgg cgacgaaccg gatggctccg cgaagttcat cacggcgttc      3180
     ttccgtgcac cggcggtcac cgaggccgtg cgcgacctgc tcaacaaccg tgacggtctc      3240
     atgctcggca tctgcaacgg gttccaggcg ctcatcaagc tcggtctcgt gcccttcggc      3300
     gacattgtgc ctatgaccgc ggagtgcccg acgcttacgt tcaacaccat cggacgccac      3360
     cagagccgtc ttgtacgcac acgcgtcgcg tcgaacctgt cgccgtggct tgccaagacg      3420
     gaggtgggcg atatgcacac catcgccatc tcccatggcg agggacgttt cgtcgcttcc      3480
     gacggcatgc tcgaccagct catcgcaaac gggcaggttg ccacacagta cgttgacgaa      3540
     catggcgtgc cgagcatgga cctgagtgtg aacccgaacg gctccatgct cgccatcgag      3600
     ggcatcacca gcccggatgg ccgcgtgttc ggcaagatgg gccactccga gcgcaccggc      3660
     gacggcctgt accgcaatgt gcccggcaac atctaccagc cgatcttcga agccggcgtc      3720
     gagtacttcg gctga                                                       3735
//

If you have problems or comments...

PBIL Back to PBIL home page