(data stored in ACNUC30630 zone)

EMBL: CP001606.PE591

CP001606.PE591       Location/Qualifiers
FT   CDS_pept        726588..726722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47556"
FT                   /protein_id="ACS47556.1"
FT                   /translation="MDARPVGDSKPRHAAESEKCVPYVMAGEWWNIPFAPLLSMVMGS"
     gtggatgccc ggcctgtcgg cgacagcaag ccgaggcatg cggcagagag cgagaaatgt        60
     gtgccatatg tgatggccgg cgaatggtgg aatatcccgt tcgccccgtt gttgagtatg       120
     gtgatgggaa gctag                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page