(data stored in ACNUC30630 zone)

EMBL: CP001606.PE601

CP001606.PE601       Location/Qualifiers
FT   CDS_pept        735752..739162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0626"
FT                   /product="Carbamoylphosphate synthase large subunit"
FT                   /note="COG0458 Carbamoylphosphate synthase large subunit
FT                   (split gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47566"
FT                   /protein_id="ACS47566.1"
FT                   /translation="MPKRTDIKSVMVIGSGPIVIGQAAEFDYSGTQACRVLREEGVRVI
FT                   LVNSNPATIMTDPEMADATYIDPISTPILEKIIAKERPDALLPTLGGQTALNAAVALGE
FT                   AGVLKKYNVELIGASLEAIDRGEDRESFKKVVKEAGAESARSDIAHTLEEVDAIAERFG
FT                   FPLVVRPSFTMGGLGSGIAHDTEELHRIAGAGIHYSPTDEVLIEEGIEGWKEYELELMR
FT                   DRNDNVVVVCPIENVDPVGVHTGDSITVAPVFTLTDREYQKLRDIGIAIIRGVGVDTGG
FT                   CNIQFAIHPDTGRIIVIEMNPRVSRSSALASKATGFPIAKIATKLALGYTLDEIQNDIT
FT                   RSTPASFEPTIDYVVTKVPRFAFEKFPGADPTLTTSMKSVGEAMALAGNFQESLGKAMR
FT                   SIDKRHMGFSWDGEKPSEGEVHELLEQMRIPTEHRYLQVMRAIWGGATPEQIFNATKID
FT                   PWFIDQFFQINATAMQVRGAETLSKRLLRKAKLAGLSDVQIAHLRRLGDEGENTIRELR
FT                   WNYGLHPVFKTVDTCAAEFAAQTPYYYSCYADETELRKREREAVIILGSGPNRIGQGIE
FT                   FDYTCVHAVQELGKDYDTIMVNCNPETVSTDYDMSDRLYFEPLTFEDVLEIYEAEKKQG
FT                   PIKGVIVQLGGQTPLSLAARLKAAGVPILGTTPEAIDLAENRELFGEVLRQEHLNAPRF
FT                   GTALSLEEAREAAHNIGYPVLVRPSYVLGGRGMEIVYDDAQLETYVNRALSEAKADTVV
FT                   SGRLPSPLLIDKFLQDAIEIDVDALFDGEELYIGGIMEHIEEAGVHSGDAACTLPPSTL
FT                   SDDQIRRLREATLAIAKGCQVRGLMNVQYAFMANTLYVIEANPRASRTVPFASKATGVA
FT                   LAKAAARIMAGETIEQQRENGLLLPYGDGGDVRLGQQVAVKESVLPFKRFRTPVGKTVD
FT                   ILLGPEMRSTGEVMGFDRDFPHAFAKSQLASYEGGLPTNGNVFISVNDTDKRQLPLFAV
FT                   RLVELGFEIWATEGTASVLRRYGIESKIVDKIHSRVDTDPEHPIEIQHAAGSVGKNVVE
FT                   LIEEGQIDLILNTPNSRGSRSDGYSIRAAAIAADIPQYTTMTEFSAVLLAIEAVKKNDY
FT                   EVMSIQEHSRELYELERKHKEEGEEARAQ"
     atgcctaagc gcacagacat caagtcggtg atggtcattg gctccggccc gatcgtgatc        60
     ggccaggcgg ccgaattcga ttactcgggc acccaggcat gccgggtgct gcgcgaggaa       120
     ggcgtgcggg tcattctcgt caactcgaat cccgccacga tcatgaccga tccggagatg       180
     gccgatgcca cctacatcga cccgatctcg actcccattc tcgagaagat catcgccaag       240
     gaacgcccgg atgcattgct gcccacgctt ggcggccaga ccgcattgaa cgccgcagtg       300
     gctcttggcg aggccggtgt gctcaagaaa tacaatgtgg agctcatcgg cgcctcgctg       360
     gaagccatcg accgcggtga ggaccgcgag tcgttcaaga aggtggtgaa ggaggcaggc       420
     gccgagtcgg cgcgctccga catcgcccac accttggagg aagtggacgc cattgccgaa       480
     cgattcggct tcccgctggt cgtgcgtccg tcgttcacca tgggaggcct tggctcaggc       540
     atcgcgcatg acaccgagga gctgcaccgc atcgccggtg ctggcattca ctattcgccg       600
     accgacgagg tgctcatcga agagggcatt gagggctgga aggaatacga gctcgagctc       660
     atgcgcgacc gcaacgacaa cgtcgtggtc gtctgcccga tcgagaacgt cgacccggtc       720
     ggcgtgcaca ccggcgactc gatcaccgtc gccccggtct tcacgctgac cgaccgcgag       780
     tatcagaagc tgcgtgacat tggcatcgca atcattcgcg gtgtgggtgt cgacaccggc       840
     ggctgcaaca tccagttcgc cattcacccc gacacgggcc gcatcatcgt catcgagatg       900
     aacccacgcg tatcgcgttc ctccgcgctg gcgtcgaagg ccacaggctt cccgatcgcc       960
     aagatagcca cgaagctcgc gctcggctat acgctcgacg agatccagaa cgacatcacg      1020
     aggtcgacac ctgccagctt cgagcccacc atcgactatg tggtcaccaa ggtgccgcgg      1080
     ttcgctttcg agaagttccc gggcgccgat ccgacgctga ccacttcgat gaagtcggtg      1140
     ggcgaggcca tggccttggc tgggaacttc caggagtcgc ttgggaaggc catgcgctcc      1200
     atagacaaac gccatatggg cttcagctgg gacggcgaga agcctagcga gggcgaggtg      1260
     cacgagctgc tcgagcagat gcgcattccc accgaacacc gttacctgca ggtcatgcgt      1320
     gcgatctggg gaggtgcgac gccggaacaa atcttcaacg ccacgaagat cgacccgtgg      1380
     ttcatcgacc agttcttcca gattaacgct accgccatgc aggtgcgcgg cgcagagacg      1440
     ctctcgaagc gcctgctcag gaaggcgaag ctcgctggtc tgtcggacgt gcagatcgca      1500
     catctgcgca gactcggtga cgaaggcgaa aacacgattc gcgaactgcg ctggaactac      1560
     gggctgcacc cggtgttcaa gacggtcgat acctgtgccg ccgaattcgc cgcgcaaaca      1620
     ccgtactact attcgtgcta tgccgatgag accgaactgc gcaagaggga acgcgaggct      1680
     gtgatcattc tcggctccgg acccaaccgc atcggccagg gcatcgagtt cgactacaca      1740
     tgcgtgcacg ctgtgcagga gctcggcaag gactatgaca cgatcatggt caactgcaat      1800
     cccgaaaccg tgtccaccga ctacgacatg tcggatcgcc tatatttcga accgctcacc      1860
     ttcgaagacg tgcttgagat ctatgaggcc gagaagaagc agggcccgat caagggtgtg      1920
     atcgtgcagc tcggtggcca gacgccgctt tcgctcgccg cacgtctcaa ggccgccggc      1980
     gtgccgattc tcggcacgac ccccgaggcc atcgacttgg ccgagaaccg tgagctgttc      2040
     ggtgaggtgc tgcgtcagga acatctcaac gcgccgcgtt tcggcaccgc gctgagcctc      2100
     gaagaggccc gtgaggccgc ccacaacatc ggctacccgg tgctggtgcg ccccagctac      2160
     gtgctcggcg gccgcggcat ggagatcgtg tacgacgatg cgcagctgga gacctatgtg      2220
     aaccgcgcac tgagtgaggc gaaagccgac accgtggtgt cggggcgtct tccctccccg      2280
     ttgctcatcg acaagttcct gcaggacgcc atcgaaatcg acgtcgatgc gctgttcgat      2340
     ggcgaggaac tgtatatcgg cggcatcatg gaacacattg aggaggcggg cgtccattcc      2400
     ggcgacgctg cctgtacatt gccgccgagc acgctgagcg acgaccagat tcgacgtctg      2460
     cgcgaggcga ccctggccat agccaagggt tgccaggtac gcggtctcat gaatgtgcag      2520
     tatgccttca tggccaacac gttgtatgtg atcgaggcga atccacgcgc ttcgcgcacc      2580
     gtgccgttcg catccaaggc caccggcgtg gctctggcga aggccgcggc ccgcatcatg      2640
     gcaggcgaaa cgattgagca gcagcgtgag aacggcttgt tgctgcctta tggcgatggc      2700
     ggcgatgtgc gcctcggcca gcaggtcgcc gtgaaggaat cggtgctgcc gttcaagcgc      2760
     ttccgcacgc cggtcggcaa gaccgtcgac attctgcttg ggcccgagat gcgttccacc      2820
     ggcgaggtga tgggattcga ccgcgatttc ccgcatgctt tcgccaagag ccagctggcc      2880
     tcctacgagg ggggactgcc gacgaacggc aacgtgttca tctcggtgaa cgacaccgac      2940
     aagcgtcagc tgccgttgtt cgccgtgcgt ctggtggagc ttgggttcga gatctgggcc      3000
     accgagggca ccgcatcggt gctgcgccgc tacggcatcg aatcgaagat cgtcgacaag      3060
     attcacagcc gggtggacac cgatccggag catccgattg aaatccagca tgccgcgggt      3120
     agcgttggca agaacgtcgt cgagctcatc gaggaaggcc agatcgatct catcctcaac      3180
     acgccgaact cccgtggctc ccgatccgac ggctattcga tccgtgccgc ggccattgcc      3240
     gccgacattc cgcagtacac aacgatgacg gagttctccg cggtgctgtt ggccatcgaa      3300
     gccgtgaaga agaacgacta cgaggtgatg agcattcagg agcactcccg tgagctctac      3360
     gaactcgaac gcaagcacaa ggaagaagga gaggaagcgc gggcgcaatg a               3411
//

If you have problems or comments...

PBIL Back to PBIL home page