(data stored in ACNUC30630 zone)

EMBL: CP001606.PE623

CP001606.PE623       Location/Qualifiers
FT   CDS_pept        complement(764370..765374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47588"
FT                   /protein_id="ACS47588.1"
FT                   /translation="MSTFGFAPALGWIGGSLVAAVMVACAVTCVVLHARRGADGTDETL
FT                   WSCVRRVLACVIVALMAFTPSMVTKTTSRAISTTDVVIVSDITPSMGVQDARYGSKSDL
FT                   SRLEAAKSAIADIVRDYPNSSFSAVSVGASGAVDVPLTPDTRAITNWAQSLDTEDSSSS
FT                   SGSSLDVVIDPLLRALKSIRDAHPDDRIVLYIITDGEQTVRNTRRTFSSLRHYIDDACV
FT                   IGVGSTTGGRIPSKTAGQWVTDPSTGQPGVSIMDEGQIRSLADELSGKVVITSANDTVA
FT                   SAQIAQQAGSWREDDTQKERTRINPIVWPLAIALAALLAWELGTWIATSRRLL"
     atgagtacgt tcggctttgc accggccctc ggctggattg gcggctccct tgtggctgcg        60
     gtgatggtgg catgcgcggt gacgtgtgtc gtgctgcatg cacgtcgcgg cgccgatggt       120
     accgatgaga cactctggtc gtgcgtaagg cgtgtgctgg catgcgtcat cgtggcgctc       180
     atggccttca caccaagcat ggtgaccaag accaccagcc gtgccatcag taccactgat       240
     gtggtcattg tctcggacat cacgccgtcg atgggtgtgc aggatgcccg ctatggctcc       300
     aagtccgacc tttcccgcct cgaagcggcg aagtccgcca ttgcagacat cgtcagggat       360
     tacccgaatt cgagtttctc cgcagtatcc gttggagcat cgggagcggt ggatgtgccg       420
     ctgacgcccg acacccgtgc catcacgaat tgggcgcagt cccttgatac cgaggattcc       480
     tcgagttcca gcggttcatc gcttgatgtg gtgatcgatc cgttgctgcg tgcactcaaa       540
     tcgattcgcg acgcccaccc ggacgatcgc attgtgttgt acatcatcac ggatggggaa       600
     cagactgtgc ggaacacacg ccgcacattt tcgtcgctgc gccactatat tgacgatgcc       660
     tgcgtgatcg gcgtcggctc caccaccggt ggccggatac cttcgaagac cgcaggtcaa       720
     tgggtcaccg atccctctac gggccagccc ggcgtatcga tcatggatga aggacagatt       780
     cggtcgctgg ccgacgagct cagtggcaaa gtggtgatca cctcggcgaa cgacacggtg       840
     gcgagcgcac agatcgcgca acaggccggg agctggcgtg aagacgacac gcagaaggag       900
     cgtacgcgca tcaatccgat tgtctggcca ctggccattg cattggctgc gttgctggca       960
     tgggagctgg gcacatggat cgccacttcg aggaggcttc tatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page