(data stored in ACNUC30630 zone)

EMBL: CP001606.PE638

CP001606.PE638       Location/Qualifiers
FT   CDS_pept        complement(778936..779958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47603"
FT                   /protein_id="ACS47603.1"
FT                   /translation="MSADDESADNVGETSAQMTAAPESVTQSTTDDQDEVHGTVVPPSF
FT                   PPHHEETDPASDSEDTDAKQRPSKSARGGARRHLPMHITTIVLGIIVILIAGLYLYANG
FT                   NISGTPRAAAMSDCRSSVSHANSARSLLTTAVGDAKTYRASHVTDMSDEQLRNLTSYLD
FT                   QSAQQPSVPSCSIIANDGVLQTNAVNAKKLAHNATTLTRDLLLATTGVLPQELQGDEQT
FT                   GDPSYSPSETQMPTESPQPPTSPSTDSSTHGTTSDDAKSHNDSGTANELASPSAQPSNT
FT                   SRTSPEPSPSPSASMSTSSEDAGTGKRKQKESGSSASSQSEGNGSNTTKSNGTKSGNVM
FT                   "
     atgagtgcgg atgacgagtc tgcagacaat gtcggcgaaa cgagcgcgca gatgaccgca        60
     gccccagagt cagtgacgca atcgacaacg gacgatcagg atgaagtgca tggcacggta       120
     gtgccaccgt cattcccccc gcatcatgag gagacggatc cggcctcgga tagcgaagat       180
     accgatgcca agcagcgccc ctcgaagagc gcccgcggcg gagccagacg gcatctgccc       240
     atgcatatca ccacgatcgt gctcggcatc attgtgatcc taatcgccgg attgtacctg       300
     tatgccaatg ggaacatatc gggaacgcct cgcgcggccg caatgagcga ttgccgatcc       360
     agcgtctctc acgcgaattc ggcgcgcagc ctgctcacca ccgcagtggg cgatgcgaaa       420
     acataccggg catcgcatgt cacagacatg tccgatgagc aactgcgcaa tttgacctcg       480
     tatctcgacc aatccgcaca acagccgtcg gtgccgtcat gctcaatcat cgccaacgat       540
     ggcgttctgc aaaccaatgc cgtcaatgcc aagaagctcg cacacaacgc cacaacgctg       600
     acccgcgatc tgctgctggc gacgaccggc gtgctccccc aggaactgca gggcgatgag       660
     cagacgggtg acccttcata ctcgccgtcc gaaacacaaa tgccaaccga atcgccgcag       720
     ccacccacct ccccgagcac cgattccagc acccatggca cgacatcaga tgatgcgaag       780
     tcacacaacg acagcggcac agccaacgaa ctcgcatctc cctcggcgca gccctccaac       840
     acctccagaa cctcgccgga acccagtccc tcgccatccg ccagcatgtc gacctcctcc       900
     gaagatgcgg ggacaggcaa gcgcaaacag aaggagtccg gctcgtccgc atcctctcaa       960
     tccgaaggaa acgggtcgaa cacgacgaaa tccaacggga cgaaatcggg caatgtcatg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page