(data stored in ACNUC30630 zone)

EMBL: CP001606.PE645

CP001606.PE645       Location/Qualifiers
FT   CDS_pept        790310..791095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0670"
FT                   /product="ATP-binding protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47610"
FT                   /protein_id="ACS47610.1"
FT                   /translation="MSENNTVEQLSPSGENAHHLVELEHVEKYYGNLHVLRDINLKVDK
FT                   GEVLVIVGPSGSGKSTMCRTINRLETIDSGVIRIDGQALPQEGKGLAQLRAEVGMVFQS
FT                   FNLFANKTILENVTLAPIKVRHMDRDQAEKEAMDLLARVGVDSQAMKMPSQLSGGQQQR
FT                   VAIARSLAMHPKVMLFDEPTSALDPEMVNEVLDVMVELAQEGMTMLCVTHEMGFARKAA
FT                   NKIVFMADGQILERGTPDEFFEHPQTERAQEFLSKILTH"
     atgagcgaaa acaacactgt ggaacaattg tcgccgagcg gcgagaacgc ccatcatctc        60
     gtggaactcg agcatgtgga gaagtactac ggtaatctgc atgtgctgcg cgacatcaat       120
     ctgaaagtag acaagggcga ggtgctcgtg attgtcggac cgtcgggctc gggcaagtcg       180
     acgatgtgcc gcaccatcaa ccgattggag accatagact ccggtgtcat ccgcatagac       240
     ggccaggcat tgccccagga gggcaagggt ctggcccagt tgcgcgccga agtgggcatg       300
     gtgtttcagt cgttcaatct gttcgcgaac aagacgatcc tggagaacgt cacgcttgcg       360
     ccgatcaagg tgcgtcacat ggaccgcgat caggccgaga aggaggccat ggacctgctt       420
     gcgcgagtcg gcgtcgattc gcaggccatg aagatgccgt cgcagctatc gggtggacaa       480
     cagcagcgcg tggccatcgc gcgctcgctg gccatgcatc cgaaggtcat gctgttcgac       540
     gagccgacct cggcgctcga ccctgagatg gtcaacgaag tgctcgacgt catggtcgaa       600
     ctcgcccagg aaggcatgac gatgctgtgt gtcacacacg agatgggttt tgcgcgcaag       660
     gcggccaata agatcgtgtt catggccgac ggccagattc tcgaacgtgg cacgcccgac       720
     gagttcttcg agcaccccca gacggagcgt gcccaggagt tcctgtcgaa gattctcacg       780
     cactga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page