(data stored in ACNUC30630 zone)

EMBL: CP001606.PE670

CP001606.PE670       Location/Qualifiers
FT   CDS_pept        822272..824863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0695"
FT                   /product="LigA"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47635"
FT                   /protein_id="ACS47635.1"
FT                   /translation="MEDALIADEQLDRYPIGSDPWIDSLRDIDSDAMELDDLDVSKLNV
FT                   EQAVRLWSRLSAWVEGDQVAYYVKDAPLSSDAAYDARMNCLKRLESEFPQLDTPQSPTH
FT                   RVGGTFSNDFTAVRHPSQMMSLDDVFSFEELRAWYDGVRKDLEWPEDKLLPMTCEVKID
FT                   GLALNLIYRNGVLTQGLTRGDGVTGEDITMNVRTIHSIPTNLDGPEGDIPDMVEIRGEV
FT                   FMRWDDFHKLNEANEDAGRPPFANPRNAAAGSLRQKDPRITAQRHLSFYAHGIGELVWG
FT                   SGKPVDVADEVRNQSDAYTMYRKWGVPISPHNREVTDFDQILDMIEYYGEHRGDIEHAL
FT                   DGIVVKVDDLALQRRLGSTSRAPRWAIAYKYPPEEVNTKLLNIVVQVGRTGRVTPVAIL
FT                   NPVYVAGSTVSRTTLHNAYEVKRKGILIGDTVVVRKAGDVIPELVGPVIAKREGHEQDL
FT                   REFVMPTRCPSCDTVLRYEKEGDKDLRCPNSESCPAQLAERVINLAARKAFDIEHLGDQ
FT                   SAVALTNPEDNRPDSVEAYAPGVREIVVEPGEEPAPYLAPSGLELPPIQEPVLTSEANL
FT                   FDLEASDLRDVYVWREAQIIEVRRHVDSHGKERKVRHRLGGSGLWHREPAFWSGVKDAP
FT                   LKKDANRKTVKDSEGNPEYEVKPDAVIVGHGRNGRPRIEEPTENTRKMLDEIEKAKHTD
FT                   LSRVLVALSIRHVGPPTAFTLAKHFKTLDALADASAEELEQIDGIGAEIADSIATFFEE
FT                   ARMPGNWRGRVLEAWKAAGVGMSTHDEGLPQTLEGKSVVVTGTLEHFSRESAKEAIERR
FT                   GGKASGSVSRKTDWVVVGANPGSKATKAEELGIPIIDEQQFDTLLATGDVQ"
     atggaagatg cattgattgc agacgagcag ctcgacaggt atccgattgg ttcggatccg        60
     tggattgact cattgcgtga catcgacagt gatgcgatgg aacttgatga tctcgacgtg       120
     tcgaagctca atgtagagca ggcggtgcgg ctgtggtcac gtctgagtgc ttgggtggag       180
     ggcgatcagg tggcctatta cgtcaaggac gccccgcttt cctccgatgc agcgtacgat       240
     gcgcgcatga attgcctcaa acgactggag tcggagttcc cccagcttga cacgcctcag       300
     tcaccgaccc atcgggtagg tggcacattc tcgaacgact tcacggcggt gcggcacccc       360
     tcccagatga tgagcctcga tgatgtgttc tccttcgagg aactgcgtgc ctggtacgat       420
     ggcgtgcgca aggacctcga atggccggaa gacaagctgt tgcccatgac ctgcgaggtg       480
     aagatagacg gtctggctct gaatctcatc taccgcaacg gagttctgac gcagggactc       540
     acccgtggtg atggggtcac tggcgaagac atcacgatga atgtgcgcac gatacactcc       600
     atccccacca atctggatgg cccggagggc gatattcccg atatggtgga gattcgcggc       660
     gaggtgttca tgcggtggga tgattttcac aagctcaacg aggcgaacga agatgcgggc       720
     agaccaccgt tcgccaatcc acgcaatgcg gccgcgggat cgctacgcca gaaggatccg       780
     cgcatcaccg cgcagcggca tctgagtttc tatgcacatg gcatcggcga actggtatgg       840
     gggtcgggca agccggtgga tgtggccgac gaggtgagga accagtcgga tgcctacacg       900
     atgtaccgca aatggggggt gccgatttcg ccccataacc gcgaggtcac cgacttcgac       960
     cagattctcg acatgatcga atactacggc gagcaccggg gtgacatcga gcatgcgctc      1020
     gacggcattg tggtcaaagt ggacgacctc gcgttgcaac gcagactggg cagcacctca      1080
     cgcgcgccgc gttgggccat cgcctacaaa tacccgcccg aggaggtcaa caccaagctc      1140
     ctcaatattg tggtgcaggt cgggcgcacg ggcagagtca caccggtggc catactgaac      1200
     ccggtgtatg tggccggatc cacggtgtcg cgcaccacgc tgcacaatgc atacgaggtc      1260
     aaacgcaaag gcattctcat cggcgatacg gtggtagtgc gcaaggccgg cgatgtgatc      1320
     cccgaactgg tcggcccagt aatcgccaaa cgcgaagggc atgaacagga cctacgcgag      1380
     ttcgtcatgc ctacacgatg cccatcctgt gacaccgtgt tgcggtatga gaaggaggga      1440
     gacaaggacc tgcgatgccc gaattcggaa agctgcccgg cccagctcgc cgaacgtgtg      1500
     atcaatctgg cggcccgcaa ggcattcgac attgagcatc tgggtgacca aagcgcggtg      1560
     gcgctgacga accccgaaga caacaggccg gactcggtgg aagcctacgc ccccggcgtg      1620
     cgtgagatcg tggtggaacc aggcgaggag ccggcaccgt atctggctcc gagcgggctg      1680
     gaacttccgc ccatccagga gcccgtactc accagtgaag cgaatttgtt cgacctcgaa      1740
     gcaagcgacc tccgggatgt ctatgtgtgg cgtgaagcgc agatcatcga agtgcgcagg      1800
     cacgtggatt cgcatggcaa ggagaggaag gtgcgccatc gtctcggcgg ttccggcctg      1860
     tggcataggg agccggcttt ctggtccggg gtcaaggatg ccccgctgaa gaaggacgcg      1920
     aatcgcaaga cggtgaagga ctccgaaggc aaccccgaat acgaggtcaa accggatgcc      1980
     gtgattgtgg gccatggcag gaatgggcgg ccgcgcatcg aggaacccac cgagaacacc      2040
     aggaagatgc tcgatgagat cgagaaagcc aagcataccg atctgagccg cgtcctcgta      2100
     gcgctctcca ttcgccatgt gggcccaccg accgcattca cgctggccaa gcactttaag      2160
     acactcgatg cgctggccga cgccagtgcc gaggaactcg aacagatcga cggcataggc      2220
     gcggagatcg ccgattccat tgcgacattc ttcgaggagg ctcgcatgcc gggcaattgg      2280
     cgcggccgtg tgctggaggc gtggaaagcc gccggtgtgg gcatgagcac gcatgacgag      2340
     ggtcttcctc agacgttgga aggcaagagc gtggtggtca ccggcaccct tgagcatttc      2400
     tcccgcgaat cggctaagga ggccatcgaa cgccgtggcg gcaaggcctc cggatcggtg      2460
     agcaggaaga cggattgggt ggtcgtcgga gccaatcccg gttcgaaggc cacgaaggcc      2520
     gaggaactgg gcatcccgat catcgacgag caacagttcg acactttgct cgccaccggc      2580
     gacgtgcaat ga                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page