(data stored in ACNUC30630 zone)

EMBL: CP001606.PE681

CP001606.PE681       Location/Qualifiers
FT   CDS_pept        835980..836834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0706"
FT                   /product="hypothetical protein"
FT                   /note="COG3409 Putative peptidoglycan-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47646"
FT                   /protein_id="ACS47646.1"
FT                   /translation="MLGMPHTVESAPASSQEYSGTQQVNVVPTIAADRQLPGNATGTVT
FT                   ENWMAGELRSGSRAYQVNDRTVVALHTATPLYRDLKVGDRGEDVRSLNDELSRLGYDSV
FT                   PQSGEYNRNTGNGWRQLMVDAGNSDGAGEDDMNLRLSDTMWIPPDSVKVQGWSATRGSA
FT                   VQAGAPLGTVPGGLVRLAIRGGKPSDEGRPLTVFGVAAPLAPGTTDITDGELLQRIAAT
FT                   EGYQGKSAEERAAGMDPAHAQQGDPDPTRAGRFGVRHQWDLGMHRHRHVRQSPCRTGAH
FT                   HHQ"
     atgctcggta tgcctcatac cgtcgaatcg gcgcctgcaa gctcgcagga gtattccggc        60
     acgcaacagg tgaatgtggt gcccaccatc gcggccgacc ggcagctgcc cggtaatgcc       120
     accggaaccg tgaccgagaa ctggatggcc ggcgagctgc gctccgggtc tcgcgcctat       180
     caggtgaacg accgcacggt agtcgctctg cacaccgcaa caccgctcta ccgcgacctc       240
     aaggtgggcg accgcggcga ggatgtgcgc tcgctcaacg acgaactgtc acggctcgga       300
     tacgacagcg tgccgcaatc cggtgaatac aaccggaaca ccggcaatgg ctggcgccag       360
     ctcatggtgg acgccggaaa ttcggatggc gctggcgaag acgacatgaa cctgcggctg       420
     tcggacacga tgtggattcc cccggattcg gtgaaggtgc aggggtggag cgccactcgg       480
     ggcagcgcgg tgcaggcggg agcgccgttg ggcaccgtgc cgggagggct agtgagactg       540
     gcgatccgcg gtggcaaacc ttccgatgaa gggcgcccgc tcacggtatt cggcgtggct       600
     gccccgttgg cgcccggtac caccgacatc acggacggcg aactgctgca gcggattgca       660
     gccaccgaag gttaccaagg caagagcgct gaggaacgcg ccgccggcat ggacccagct       720
     cacgctcaac aaggcgatcc agaccctacg cgtgccggtc ggttcggtgt tcggcatcaa       780
     tgggacctcg gcatgcatcg ccaccggcac gttcgacaat ccccatgtcg taccggtgcg       840
     catcatcacc agtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page