(data stored in ACNUC30630 zone)

EMBL: CP001606.PE70

CP001606.PE70        Location/Qualifiers
FT   CDS_pept        complement(79093..80226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0072"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COG3464 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47035"
FT                   /protein_id="ACS47035.1"
FT                   /translation="MRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWSDDPEAVG
FT                   AGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLEQADRFSS
FT                   VRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLREWMQARGG
FT                   EFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRLQRDATGR
FT                   RGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRVIHAYRCD
FT                   DRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSSNGPTEAI
FT                   NGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
     gtgcgttcgt cgtggctgcg cacgctggcg catgtgccct acggcgacga cgcggtgcat        60
     ctgctggtgc gcgtgcgccg ctacgagtgc gtgccgtgct cacgctcgtg gagcgatgat       120
     cctgaggcgg tgggcgccgg caggggcgtg ttgagcgtgc cggcggtgat gtgggcgctg       180
     cggcgcgtgt gcctggactc gatgacggtc tcggcgtgcg ccaggctgct tcatgtggca       240
     tgggcggtgg tcgaccgggc ggtgcgcgag cggggcatgc tgttgctcga gcaggccgac       300
     cggttctcct cggtgcgcgc gatcggcgtg gacgagcacg tgtggcgcca cggcgcgttc       360
     ggcgaccggt acgtgaccgt gatcgtcgac ctgaccccgc gttgcgacgg caggccggca       420
     agactgctgg acatggtgcc gggccgttcc gcccaggtgc ttcgcgaatg gatgcaggcg       480
     cgcggcggcg agttcacaag acgcgtcggg gtggtcgcca tggacgcgtt cgccggctgg       540
     aagcaggccg tcgaatccgt cgtgccccac gcggtcgagg tcatcgaccc gttccacgtc       600
     gtgcaactgg ccgccgcccg cgtcaccaag gtgcgctgcc gcctgcaacg cgacgccacc       660
     ggcaggcgcg gtgtcaaggg cgacaggctc tacgactgca ggcgcgccct gctgaccagc       720
     gacgaatacc tcggcgcacg cggccgtgcc agactcatgg ccctgttcgc catccaggcc       780
     aaccgcgacc tcatgctcgc ccacgacgcc taccaaaggg tcatacacgc ctaccggtgc       840
     gacgacaggc gacgcggcga acgcatgatg cgcgagctga tcgacgacct gaccggaccg       900
     gggcgctaca aaggctgccg ggaactcgcc tccctcggcc gcgtgctcaa aagacgcatg       960
     cgcgacatcc tcgccctctt ccgccacccc cgctcaagca acggacccac cgaagccatc      1020
     aacggcaggc tcgagaccct gcgcggcaac gccatgggct tcgccaacac caccagctac      1080
     atccaacgat gcctcatcca cagcagccaa ctcaaagaca tccttacaca ctaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page