(data stored in ACNUC30630 zone)

EMBL: CP001606.PE708

CP001606.PE708       Location/Qualifiers
FT   CDS_pept        866241..867704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0733"
FT                   /product="hypothetical protein"
FT                   /note="COG0168 Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47673"
FT                   /protein_id="ACS47673.1"
FT                   /translation="MANLLFDESASNSETSKGFGWWFSGDTFERNAYEERNPHSRSLSY
FT                   RLNSHPGRLTIIYFLALITVSTSLLCLPIATQPGKKTSFSTAFFTAVSALSTCGISVVN
FT                   TTDHWTIFGQVVLIFSVQMGGLGVMTFASLIALAVNHHLKAMQRLLAANELGTNKLSEI
FT                   RGVLQVVLMTTLVIEVVTFFALFPGLLSVNKGNVGRTLWESLFFAVMSYNNAGFTPDGA
FT                   GLYVNNWAVGLPIMMSAFCGTLGFPVLLNIFRTARMHKSPKHWSLHTKITMIMTFAIVF
FT                   MSLIWFLAVEWDNPVLFKDGDVDTRMRRAMVAAVMPRSSGFDLSWVPGVKECTKVFMSI
FT                   VMFIGGGSTSTAGGIRVTTLAVILLVCKAAFTGHTDVNAFHKRIPQHVIMTAISITASC
FT                   VALVFIASVALMLITDSSLSHAMFDTCSAFGLGGYTVGVAQENNPASLYVLAAAMVVGR
FT                   LGPMTLAYAVSRPKELDVVRYPEGQIVVG"
     atggccaatc tcttgttcga tgaatcggca tccaactccg agacctccaa gggattcggt        60
     tggtggttct ctggtgacac cttcgaacgc aacgcctatg aggagcgcaa tcctcatagc       120
     cgttcgctgt cctatcgact gaactcgcat ccgggtcgtc tcaccatcat ctacttcctc       180
     gcgctcatca cagtctcgac ttcattgctg tgcctgccga tcgccaccca gcccggcaaa       240
     aagacctcgt tctcgactgc gttcttcacc gcggtttccg ctctttccac ctgcggcatc       300
     tcggtggtga acacgacgga ccattggacg atcttcgggc aggtggtgct gatcttctcg       360
     gtgcagatgg gaggcttggg cgtcatgacc ttcgcctcgc tcattgccct ggccgtcaac       420
     caccatttga aagccatgca acggttgctg gcggcgaatg aactcggcac caacaagctg       480
     tcggagatcc gcggcgtgct gcaggtggtg ctcatgacca cgctcgtcat cgaggtcgtc       540
     acgttcttcg cactgttccc gggattgctc tccgtaaaca aggggaacgt ggggcgcaca       600
     ctgtgggagt cgttgttctt cgctgtcatg tcatacaaca atgcgggatt cacacccgat       660
     ggtgcgggtc tgtacgtgaa caattgggcc gttggtttgc cgatcatgat gagcgccttc       720
     tgcgggacgc tcggcttccc cgtgctgctc aacattttcc gtacggcgcg catgcacaaa       780
     tcaccgaagc actggtcgct gcacaccaag atcacgatga tcatgacctt cgccatcgta       840
     ttcatgtcac tgatatggtt ccttgccgtc gaatgggata atccggtcct attcaaggac       900
     ggtgatgtag acacccgcat gcggcgtgcg atggtggctg ccgtgatgcc tcggagcagc       960
     ggcttcgatc tgtcctgggt gccgggggtg aaggagtgca cgaaggtgtt catgagcatt      1020
     gtcatgttca tcgggggagg ctccacttcg acggcgggtg gcatacgcgt cacgaccctg      1080
     gctgtgattc tgctggtgtg caaggccgcg ttcaccggcc ataccgatgt caatgcattc      1140
     cacaaacgaa taccgcagca tgtgatcatg accgccatct cgattacggc ctcttgcgtc      1200
     gccttggtgt tcatcgcctc ggtggcgctc atgctcatca cggactcttc gttgagccat      1260
     gccatgttcg acacctgctc ggctttcggt ctgggtggtt acacggtggg tgtggcccag      1320
     gagaacaatc ctgcgtcgct ctatgtgctg gctgccgcca tggttgtggg gcggctgggt      1380
     ccgatgacgc tggcctacgc cgtgagcagg ccgaaggaac tcgacgtggt ccgttaccca      1440
     gaaggccaga tagtcgtcgg ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page