(data stored in ACNUC30630 zone)

EMBL: CP001606.PE720

CP001606.PE720       Location/Qualifiers
FT   CDS_pept        879622..880254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0746"
FT                   /product="hypothetical protein"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47685"
FT                   /protein_id="ACS47685.1"
FT                   /translation="MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLE
FT                   RSMQTAHAFADRLGSEVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMN
FT                   HGAESHEHAGVRSMEAMNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLT
FT                   SMCNAHWARLRRADIDMDSRWIMEDYNHGPALADTQYWERPDTLPAK"
     gtgcagggat cgatcgacat tccgctcgat gaggtcgggc tgtggcaggt gaaccagtcc        60
     gcgcagtcac tgattaagct atatgtgctc ccagacccat ctcggcacca gctcgttgtg       120
     tcctccgacc tcgaacgttc gatgcagacg gcacatgcct tcgccgatag actggggtcc       180
     gaagtgcatg ccgacgaacg gttgcgcgag cggcatttcg gtgaattcga aggccgatcc       240
     ggcgcatacc tgcaggccaa tttcccgcag gacttcgact cgtggtgccg gggcatgggc       300
     ggcgagatga atcatggcgc cgaatcccac gaacatgccg gtgtccgcag catggaggcc       360
     atgaatgatt gggcccatga atgcgatgac gacaccgact tgttcgtatt ctcccatggc       420
     gcgctcatcg aaaacgcgct gcaggtgctg ttcggcatcg aacgacgata cccggatttc       480
     acgctcacct cgatgtgcaa cgcgcactgg gccagactga gaagggccga tatcgacatg       540
     gacagccggt ggatcatgga ggactacaac catggacccg ccctggccga tacacagtat       600
     tgggagcgcc cagacacttt gccagcgaaa tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page