(data stored in ACNUC30630 zone)

EMBL: CP001606.PE721

CP001606.PE721       Location/Qualifiers
FT   CDS_pept        880354..881283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47686"
FT                   /protein_id="ACS47686.1"
FT                   /translation="MKNFFKGISFSQLLAGALAAVTSFLLSSKIGIAGSVIGVAVASIV
FT                   STAASQLYQNVIDASSKKLQDAAQQVGVAPPHANAHTGDHSTADIDDTQTIAPVHSDSS
FT                   RGARTVVSGTHATDASKHPQAGTKPQMTKHDKRVAVIVALISGLVAVGITAGVILALTG
FT                   GKGTDSVVRDVVSPTYSQTPAEMPTQTPTQTPAPTQSGEGSDTDSRHTKDSSTSDRNGQ
FT                   SSGSSSGNANTGSGNSGSDSSNPGSSGSSGSQNSNGSGTAGTGSAGQDGNSGDTQNTDS
FT                   GNGDSGGSVNDGTNSGTTQKKDGSQAQQ"
     gtgaaaaact tcttcaaagg aatatcgttc tcgcagctgc tggcaggcgc cttggccgcg        60
     gtgacatcgt ttctgctgtc gtcgaagatc ggcatcgcag gttcggtaat cggcgtggcc       120
     gtggcctcca tcgtctccac tgcggcttcc cagctctatc agaacgtgat tgacgcgtcg       180
     agcaagaaac tccaggatgc cgcacaacag gttggggttg ctccgccgca tgccaatgca       240
     catacaggcg accactccac ggccgatatc gacgacacac agaccatcgc acctgtacat       300
     tccgatagct cccgtggcgc acgcaccgtg gtctccggaa cccatgccac cgatgcttcg       360
     aagcacccgc aggctggtac gaagccgcag atgaccaagc atgacaaacg tgtggccgtg       420
     attgtcgcac tgatttccgg tctggtggcg gtgggcatca ccgcaggtgt catcctcgcc       480
     ttgacgggag gcaagggcac cgactccgtg gtgcgtgacg tggtcagccc cacttactcg       540
     cagacgccgg ccgagatgcc cacccagacg cccacacaga caccggcgcc cacgcagagc       600
     ggagagggaa gtgataccga ttcgcgtcat acgaaggatt cttcgacatc ggacaggaat       660
     ggacaatcct cgggatcctc ttcgggcaat gcgaatactg gttcggggaa ctcaggctct       720
     gactcatcga accccggatc ctcagggtcg tccgggtccc agaactcgaa tgggtctggg       780
     actgcgggca ccggttccgc tggtcaggac ggcaattcgg gtgatacgca gaacacggat       840
     tccggcaatg gtgattcggg aggttccgtc aatgacggaa ccaattcagg caccacccag       900
     aagaaagacg gttcgcaagc tcagcaatag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page