(data stored in ACNUC30630 zone)

EMBL: CP001606.PE730

CP001606.PE730       Location/Qualifiers
FT   CDS_pept        891663..892292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0758"
FT                   /product="Putative ATPase"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47695"
FT                   /protein_id="ACS47695.1"
FT                   /translation="MNTIHHMLEPNPSPAPRQPDSTITLQVPTAQAMHELGERLARSLH
FT                   GGEVILLSGPLGAGKTTLAQGLGEGLGIQEPIVSPTFTIARELDGTLADGTPAHLIHVD
FT                   AYRLGSNDYAPGQAQADLLLDELESLGLDEELEEPGTRTIILMEWGEQMAVALADERLE
FT                   IRIQRPTDHVSAPIGRNEPTADGERIVTITPVGTRFALAEPADTQA"
     atgaacacca tccaccatat gctcgagccc aacccgtcac ccgcaccacg acaacctgac        60
     agcacgatta ccttgcaagt gccgaccgca caggccatgc acgagctggg cgagcgactc       120
     gcccgcagcc tgcacggtgg tgaggtgatc ctgctttcag ggccactcgg cgcaggcaag       180
     accacattgg cgcaaggatt gggggaaggc ctgggcattc aagaacccat cgtctcaccg       240
     accttcacca tcgccaggga actcgacggc accctcgcgg acggcactcc cgcacatctg       300
     atccacgtgg atgcctaccg gcttggatcc aatgactacg ccccaggtca ggcacaggcc       360
     gacctgctcc tcgacgaact cgaatccctc ggcctcgacg aggaactcga agaaccgggc       420
     acacgcacca tcatcctcat ggaatggggc gaacaaatgg cagttgcgct cgccgacgaa       480
     cgcttggaga tccgcatcca aagacccacc gaccatgtgt ctgcccccat aggccggaac       540
     gaacccaccg cagatggtga acgcatcgtc accatcaccc cagtgggaac acgattcgcc       600
     ctggcggaac cagccgacac ccaagcctga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page