(data stored in ACNUC30630 zone)

EMBL: CP001606.PE735

CP001606.PE735       Location/Qualifiers
FT   CDS_pept        895857..896234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47700"
FT                   /protein_id="ACS47700.1"
FT                   /translation="MSRNTDDRRALAAIESERMEDQIAYYRKPFMVLWAAVQEASSELE
FT                   EDYGLSSDVSQLWVAERLRQVSDSLVDRLAEKAVQHGTSKSNVARAADSDPTNAMRRFP
FT                   RLRPGAVRTRLLIDEVLDSLE"
     atgagcagga acactgatga ccggcgtgct cttgcagcga tcgagagcga acgcatggaa        60
     gaccagatcg cttattaccg taagcccttc atggtgctgt gggcggctgt tcaggaggct       120
     tcgtcggaat tggaagagga ttatggactc tcttccgacg tctcgcaact ctgggtggct       180
     gaacggctgc ggcaggtgtc ggattcattg gtggacagat tggccgagaa agccgtgcaa       240
     catggcacca gcaaatcgaa cgtggcacgt gccgccgatt cggatccaac gaatgccatg       300
     cgcagatttc ctcgtcttcg accgggagct gttcgcaccc gactgcttat tgacgaggtg       360
     ctcgattcgc tggaatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page