(data stored in ACNUC30630 zone)

EMBL: CP001606.PE752

CP001606.PE752       Location/Qualifiers
FT   CDS_pept        912812..913582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0782"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /note="COG0107 Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47717"
FT                   /protein_id="ACS47717.1"
FT                   /translation="MSLAVRVIPCLDVDDGRVVKGVHFENLRDAGDPVELAAEYYRQGA
FT                   DELTFLDVTASSSHRQTMVNVVTRTAEQIFIPLTVGGGVRTPEDVDSLLRCGADKVSVN
FT                   TAAINDPTLISRVAERFGNQVLVLSVDARRERGEQHTQSGFEVTTMGGRKSTGIDALWW
FT                   ARRAEELGAGEVLLNSMDADGTQQGFDLEMIRAMREVVSIPIIASGGAGKAQDFPPAIA
FT                   AGADAVLAASIFHYGKVTIGEVKDELRRAGYAVR"
     atgtcgttgg cggtacgtgt gattccctgc ctggatgtcg atgacggacg tgtggtcaag        60
     ggcgttcatt tcgaaaacct cagggatgcc ggggatccgg tggagctcgc agcggagtat       120
     taccgtcagg gggccgatga gctcacgttc ctcgatgtga ccgcctcgag ctcgcatcgt       180
     cagactatgg ttaacgtcgt cacgcgcacc gcggaacaga ttttcattcc gctcacggtc       240
     ggagggggcg tgcgcacgcc cgaagatgta gattcgttgc tgcgctgcgg tgcggacaag       300
     gtgagcgtga acaccgcggc cattaacgat ccgacgctga tcagccgcgt tgccgagcgt       360
     ttcggcaatc aggtgctggt gctgtcggtg gatgcccggc gtgagcgtgg ggagcagcat       420
     acgcaatccg gattcgaggt cacaacgatg ggtggccgta aatccaccgg catcgacgcc       480
     ctgtggtggg cgaggcgtgc cgaggagctg ggtgccggcg aggtgctgct caattcgatg       540
     gatgcggatg gcacgcagca gggcttcgat ctggagatga tccgtgcaat gcgcgaggtg       600
     gtgtctattc cgatcatcgc ctccggaggc gcaggaaagg cacaggattt cccgcctgcc       660
     atcgccgccg gcgcggacgc cgtacttgcc gcatcaatct tccactacgg caaggttaca       720
     atcggcgagg tcaaggacga gttgcgccgt gctggctatg ccgtgcgcta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page