(data stored in ACNUC30630 zone)

EMBL: CP001606.PE766

CP001606.PE766       Location/Qualifiers
FT   CDS_pept        925049..925381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0796"
FT                   /product="hypothetical protein"
FT                   /note="COG3856 Uncharacterized conserved protein (small
FT                   basic protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47731"
FT                   /protein_id="ACS47731.1"
FT                   /translation="MAAVLGLIIGVVVGLFVKPDIPIWLQPYLPIMVVAALDALLGAAR
FT                   AYFERSFSDKVFVISFFSNVVTATLLVLLGNQLGVGSQLSTAVIVVLGIRIFSNVSAIR
FT                   RFIFQG"
     atggcagcag tgctcggtct gatcatcggc gttgtagtcg gtctgttcgt gaaaccagac        60
     attccgattt ggctccaacc gtatcttccg atcatggtgg tggcggcact tgatgcgttg       120
     cttggcgcgg cacgtgccta cttcgagcgc agcttctccg acaaggtgtt cgtgatctcg       180
     ttcttctcca atgtcgtcac cgcaacactc ctggtgctcc tgggcaacca acttggtgtg       240
     gggtcgcaac tctccaccgc tgtcatcgtc gtgcttggca tccgcatctt ctccaacgtc       300
     tcggcaatcc gccgtttcat cttccagggg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page