(data stored in ACNUC30630 zone)

EMBL: CP001606.PE768

CP001606.PE768       Location/Qualifiers
FT   CDS_pept        926269..926709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0798"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47733"
FT                   /protein_id="ACS47733.1"
FT                   /translation="MTDPIPSAGETTIIGMPAIQIPVTTSGERPLTQEDLQTISRLADD
FT                   TALLIATRGALSGSRYLLDEDEVTVGRDPRADILLDDSTVSRQHAVFRRENGAYTVIDA
FT                   GSLNGTYVNRQRVDKATLKNGDEIMIGKFRLIYFTNSAVRNI"
     atgactgatc caattccaag tgcaggcgaa accaccatca tcggcatgcc tgccatccag        60
     attccagtga ccaccagcgg tgagcgtccg ttgacgcagg aggatctgca gaccatctcc       120
     agactggcgg acgacacggc tctgcttatc gcaacacgtg gcgctctttc cggttcgcgt       180
     tacctgctcg atgaagacga ggtgaccgta ggcagggacc cgcgcgccga cattctgctc       240
     gacgattcca cggtctcgcg ccagcatgcc gtgttccgcc gcgaaaacgg cgcttacacg       300
     gtgattgatg ccggcagcct caacggcacc tatgtgaacc ggcagagggt cgacaaggcg       360
     acgctcaaga atggcgatga gatcatgatt ggcaagttcc gcctgatcta tttcacgaac       420
     agcgcggtgc gtaacatctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page