(data stored in ACNUC30630 zone)

EMBL: CP001606.PE774

CP001606.PE774       Location/Qualifiers
FT   CDS_pept        complement(930024..930371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47739"
FT                   /protein_id="ACS47739.1"
FT                   /translation="MAERSLRGMSIGAKSLESDDNVDFAARVEVAYVCPKGHRTILPFA
FT                   ESADLPNEWECRCGATAHRENEEDEQPDEITKPTRTHWDMLMERRSEDELAALLEKRLK
FT                   MHHDGWIPDYE"
     atggcggaac gcagtctgcg cggcatgagc atcggcgcaa agtccttgga gtccgacgac        60
     aacgtcgatt tcgcggctcg cgtcgaagtg gcctacgtat gtccgaaggg gcaccgcacc       120
     atcctgccgt tcgccgagtc cgcggatctt ccgaacgaat gggagtgccg ttgcggcgcc       180
     accgcgcacc gtgagaacga ggaggacgag cagccggacg aaatcaccaa gccgacccgc       240
     acgcattggg atatgctcat ggagcgtcgt agcgaggacg agctggcggc attgctcgaa       300
     aagcgtctga agatgcatca cgacggctgg attccggact acgagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page