(data stored in ACNUC30630 zone)

EMBL: CP001606.PE779

CP001606.PE779       Location/Qualifiers
FT   CDS_pept        complement(937409..939541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0810"
FT                   /product="bifunctional cytidylate kinase/GTP-binding
FT                   protein"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47744"
FT                   /protein_id="ACS47744.1"
FT                   /translation="MIRVAIDGPAGVGKSSSSKALADYFGFAYLDTGAMYRACTWWCLE
FT                   RGVDLDADHVDEQQVTEIVAAFFTDGHFDISVDPQHPGVFADDVDISEQIRSQEVSSHV
FT                   SRLAAIMPVRNVLIAAQRAYIAAQSADDSFSHGRGVVAEGRDITDVVEPGAEVRILLTA
FT                   REEVRQARRNRQEQTGGVGSDDVAKRDAADSKVTHFTEASDGVTTIDNSDIDFGETLDL
FT                   MIGLVDDAIEEQAYRQYAANLDDYELDEGDEGLLDGSAFSADGESDRRKAVGVIAVVGR
FT                   PNVGKSTLVNRILGRRAAVVEDTPGVTRDRVSYDAEWAGTDFKLVDTGGWEADVEGIDS
FT                   AIASQAQIAVELADSVIFVVDALTGLTQTDERIVKLLRQAGKPVTVAVNKIDDQISEYM
FT                   AAEFWKLGLGEPYPISAMHGRGVGDLLDEAVAQMKSAEKTSGFLTPSHLRRVALVGRPN
FT                   VGKSSLLNQLSHSERSVVNELAGTTRDPVDEIVTIDGEDYLFIDTAGIKRRQHKLSGAE
FT                   YYSSLRTQAAIERSELALVLFDASIPISDQDLKVMSTAVDAGRAVVLVFNKWDLMDEFD
FT                   RQRMERLWKTEFDRVTWAQRVNLSAKTGWHTNRLAKAMTQALESWDKRIPTGKLNAFLG
FT                   KIQASHPHPVRGGKQPRILFATQASSRPPRFVIFATGFLEHGYRRFLERSLREEFGFEG
FT                   SPIQISVNIREKKRRK"
     atgattcgtg tggcaatcga tggccctgcc ggcgtgggca agtcgtcctc gtcgaaggcc        60
     cttgcagact attttggatt cgcttacctc gacacgggcg ccatgtatcg tgcatgcaca       120
     tggtggtgcc tggagcgcgg ggtcgacctg gatgcggacc atgtggatga gcagcaggtg       180
     acggagattg tggcggcctt cttcaccgac ggccatttcg acatcagcgt cgacccccag       240
     catcccggcg tcttcgccga cgacgtcgac atcagcgagc agattcgctc gcaggaggtc       300
     tcatcccacg tatccagact cgcggcgatt atgccggtgc gcaacgtgct catcgcggcg       360
     caacgtgcct acatcgcggc tcaaagcgcc gatgattcgt tctcgcacgg ccgtggtgtc       420
     gtagccgagg ggcgtgacat caccgacgtc gtggaacccg gtgcggaggt gcgcatcctg       480
     ctcacggccc gagaggaggt gcgtcaggca cgccgcaaca ggcaggagca gaccggtgga       540
     gtgggcagcg atgatgtagc gaaacgcgac gccgccgact cgaaggtcac ccacttcacg       600
     gaggcttcgg atggtgtgac gacgatcgac aactccgaca tcgatttcgg ggagacgctc       660
     gatctgatga ttggtctggt cgacgacgcg atcgaggagc aggcataccg gcaatatgcc       720
     gccaatctcg acgattacga acttgatgag ggcgatgagg gtctgctcga cggctccgca       780
     ttcagtgcag acggagagtc ggaccgccgc aaggcggtgg gcgtcatcgc agtggtgggt       840
     cgtccgaacg tgggcaagtc gacattggtg aaccgcattc tcggacgtcg cgccgcggtt       900
     gtggaggaca ctccgggtgt cacccgcgat cgggtgagct atgacgccga atgggcgggc       960
     actgacttca aactggtgga caccggcggc tgggaagccg acgtcgaagg catcgactcc      1020
     gccatcgcgt cccaggctca gattgccgtt gagctcgcgg actccgtgat cttcgtggta      1080
     gatgcgctca ccgggctcac acagaccgac gagcgcatcg tgaagctgct gcgtcaggct      1140
     ggcaaacccg tcaccgtcgc ggtgaacaag atcgacgacc agatcagcga gtatatggcc      1200
     gctgaattct ggaagctcgg ccttggtgag ccatacccga tctctgccat gcatggaagg      1260
     ggagtggggg acctgctcga tgaggccgtt gcgcaaatga aaagcgccga aaagacctcc      1320
     ggtttcctca cgccatccca tctgcgccgt gtggcgttgg tgggcagacc gaatgtgggt      1380
     aagtcgtcgc tgctcaacca gctctcgcat tcggaacgct cggtggtgaa cgaacttgct      1440
     ggcaccacgc gtgatcccgt ggatgagatc gtgaccatcg acggcgagga ttacctgttc      1500
     atcgacacgg cgggcatcaa acgtcgccag cacaagctgt cgggcgcgga gtactactcc      1560
     tcgctgcgca cccaagcggc catcgaacgc tccgagctcg ccttggtgct gttcgacgcc      1620
     tccattccga tctccgatca ggatctcaag gtcatgagca cggcggtgga tgcaggccgt      1680
     gcggtggtgc tcgtattcaa caaatgggat ctcatggatg aattcgaccg ccagcgcatg      1740
     gagcggttgt ggaagaccga attcgaccgt gtcacttggg cgcaacgtgt caatctctcg      1800
     gcgaagaccg gttggcacac gaaccgtttg gccaaggcga tgacgcaggc tctcgagtct      1860
     tgggacaagc gtattccgac gggcaagctc aacgcattcc tcggcaagat ccaagcctcg      1920
     cacccgcatc cggtgcgtgg tggcaaacag cctcgcattc tgttcgccac ccaggcgtca      1980
     agtcggccgc cgcgcttcgt gatcttcgct accggcttcc tggagcacgg gtaccgacgc      2040
     tttctggagc gttcgctacg tgaggaattc ggatttgagg gatcaccgat tcagatctcg      2100
     gtgaatattc gcgagaagaa gcgccgtaag tag                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page