(data stored in ACNUC30630 zone)

EMBL: CP001606.RPLF

CP001606.RPLF        Location/Qualifiers
FT   CDS_pept        476187..476726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="Balat_0397"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47347"
FT                   /protein_id="ACS47347.1"
FT                   /translation="MASHIGKLPIEIPAGVEVTINGQEFAAKGAKGSDSYTIPEGVTAK
FT                   VEGNEIIVTANDDLRPTRAKHGLARSIVASMVKGVHDGYSKSLDIVGTGYRAQMKGKGI
FT                   EFSLGYSHTITVNPPEGITLELPNPNQVIVKGTDKQAVGQVAANIRKLRAPEPYKGKGI
FT                   KYSDEVIRRKAGKAGK"
     atggcatcgc atattggtaa gctcccgatc gagattccgg cgggcgttga agtcaccatc        60
     aatggtcagg aattcgccgc caagggcgcg aagggttccg actcctacac catccccgag       120
     ggcgtgaccg ccaaggtcga aggcaacgag atcatcgtca ccgcgaacga cgacctgcgt       180
     ccgacccgcg caaagcacgg cctggcccgt tcgatcgtgg cctccatggt caagggcgtg       240
     catgatggct attcgaagag cctcgacatc gtcggcaccg gttaccgtgc acagatgaag       300
     ggcaagggca tcgagttctc gctcggttac tcccacacca tcaccgtgaa cccgccggaa       360
     ggcatcaccc tcgaactgcc gaacccgaac caggtcatcg tgaagggtac cgacaagcag       420
     gccgttggcc aggttgccgc gaacattcgt aagcttcgtg ctccggaacc gtacaagggc       480
     aagggcatca agtactcgga tgaggtcatc cgtcgcaagg ctggaaaggc tggtaagtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page