(data stored in ACNUC30630 zone)

EMBL: CP001606.RPMF

CP001606.RPMF        Location/Qualifiers
FT   CDS_pept        complement(346665..346859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Balat_0278"
FT                   /product="50S ribosomal protein L32"
FT                   /note="COG0333 Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47236"
FT                   /protein_id="ACS47236.1"
FT                   /translation="MALPKYKMSRANTRTRRSTWKAKAAQTITCPNCGAPTLAHVACPS
FT                   CGSYRGRVYREAIRSAHTK"
     atggcactgc caaagtacaa gatgtcgcgc gccaatacgc gtacgcgtcg ttccacctgg        60
     aaggccaagg ctgcccagac catcacttgc ccgaactgcg gcgctccgac gctcgctcac       120
     gtggcctgcc cgagctgcgg ctcctaccgc ggccgcgtct accgcgaggc gatccgttcc       180
     gcccacacca agtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page