(data stored in ACNUC30630 zone)

EMBL: CP001606.RPSB

CP001606.RPSB        Location/Qualifiers
FT   CDS_pept        904855..905766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="Balat_0773"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47708"
FT                   /protein_id="ACS47708.1"
FT                   /translation="MAQITMSEMLKAGLQFGHQTRRWNPKMKQYILTERNGIYIINLFK
FT                   TLDLIDVAYDFIKTTVAHNGTVLFVGTKKQAQEAIKNAATRVNMPYVSERWLGGMLTNF
FT                   QTVSKRVNRLKELETMDFDDVHGSGLTKKELLLLKREKDKLERQLGGIRNMTRTPSAMF
FT                   VVDINKEALAVEEAHKLGIPVVAIVDTNADPEAVEYPIPANDDAIRGIELLTNLFADAV
FT                   AEGLLERSGNASKSESNSEQPMAAWEKELLEKNEKATLRENAVVTENEVKKTDEEEGAS
FT                   SEAARADAQNEEAVAKPGEEVE"
     atggctcaga tcactatgag cgaaatgctg aaggccggtc tccaattcgg tcaccagacc        60
     cgccgttgga acccgaagat gaagcagtac atccttaccg agcgtaacgg aatctacatc       120
     atcaacctgt tcaagacgct ggatctgatc gatgtcgcct acgacttcat caagaccacc       180
     gtcgcccaca atggcaccgt gctgttcgtc ggcaccaaga agcaggctca ggaagcgatc       240
     aagaacgctg ccacccgcgt gaacatgccc tatgtctccg aacgctggct cggcggcatg       300
     ctcaccaact tccagaccgt ttccaagcgc gtcaaccgtc tcaaggaact cgagacgatg       360
     gacttcgacg acgtgcacgg ctccggtctc accaagaagg agctcctcct gctcaagcgc       420
     gagaaggaca agctggaacg tcagcttggc ggcatccgca acatgacccg cactccttcc       480
     gcgatgttcg tcgtcgacat caacaaggaa gccctggccg ttgaggaagc acacaagctg       540
     ggtatcccgg tggtcgccat tgttgacacc aacgccgatc cggaagccgt cgagtatccg       600
     attccggcca acgatgacgc catccgaggc atcgaactgc tcaccaacct gttcgcggac       660
     gcggtcgccg agggcctgct ggagcgctcc ggcaacgcct ccaagagcga gagcaactcc       720
     gagcagccga tggccgcttg ggagaaggaa ctcctcgaga agaacgagaa ggccaccctg       780
     cgtgaaaacg ccgtggtcac cgaaaatgag gtgaagaaga ccgacgagga ggagggagcc       840
     tcctccgaag ccgcacgtgc cgacgcccag aacgaagagg ctgtggccaa gccaggcgaa       900
     gaggtcgaat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page