(data stored in ACNUC30630 zone)

EMBL: CP001606.RPSL

CP001606.RPSL        Location/Qualifiers
FT   CDS_pept        727061..727369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Balat_0617"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47557"
FT                   /protein_id="ACS47557.1"
FT                   /translation="MALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSSGIEVTAY
FT                   IPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGAKKAK"
     ttggctctca agggcagccc gctgcgtcgc ggcgtgtgca cgcgtgttta caccaccacc        60
     ccgaagaagc cgaactcggc actgcgtaag gtcgctcgtg ttcgtctgag ctccggcatc       120
     gaagtcaccg cctatattcc gggcgaaggc cacaacctgc aggagcactc catcgtgctc       180
     gtgcgcggcg gccgtgtcaa ggatctgccg ggcgtgcgtt accacatcgt gcgtggtgca       240
     ctcgataccc agggcgtcaa ggaccgcaag cagggtcgtt ccctgtacgg agcaaagaag       300
     gcgaagtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page