(data stored in ACNUC30630 zone)

EMBL: CP001606.TRPA

CP001606.TRPA        Location/Qualifiers
FT   CDS_pept        919501..920370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="Balat_0789"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG0159 Tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47724"
FT                   /protein_id="ACS47724.1"
FT                   /translation="MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGF
FT                   PTMEQSLEAFATMVENGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVE
FT                   TVANAGGVPLIMSYWNLIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHG
FT                   LDRIFLVSPDSTDERLRVVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAE
FT                   NVCVGIGVSTAAQGKAVGQYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELA
FT                   EGIHNARL"
     atgaccgaat acaacaccac gccaagcggt cagccgcttg gaatcagcca tcgtcccagc        60
     ccatgccgcg agctgttcac acggttcaaa gcgcaggaca agcctgcatt cattgggtac       120
     ctgccattcg gattccccac gatggaacag tcactcgagg ccttcgccac gatggtcgag       180
     aacggtgctg acattgtcga gataggactg ccgtattccg atccggtgat ggatggcccg       240
     gtgatccagg ccgccagcca gatcgccctg aacaatggcg agcgcatagc cgatgtgttc       300
     aaggccgtgg agacggtggc caatgccggt ggagtgccgc tcatcatgag ctactggaac       360
     ctcatctacc attatggggt tgaacgcttc gccgctgatt tcgcgaatgc aggaggcgca       420
     ggccttatca ctcccgatct cattcccgac gaggcagggg agtggatcga ggcgtcggac       480
     cgccatgggc tcgatcgcat cttccttgtt tcccccgact ccaccgatga gcgtctgcgg       540
     gtggtgtgtg aaaacgcccg gggattcgtc tatgcggcat cgcgcatggg cgtgactggc       600
     gaacggtcga gtctagggac ttccccggag gatcttgtgg cccggacccg taaggccggg       660
     gccgagaatg tgtgtgtggg catcggcgtc tccaccgctg ctcaaggcaa ggccgtcggg       720
     cagtatgcag acggggtcat cgttggatcc gccttggtcc acaccctgct caccgaggat       780
     ggcgatgcgc gcgagctcac ctcaggtctg gctgcgttgg cggccaagac cgcagaactc       840
     gccgagggca tccacaacgc acgcctgtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page