(data stored in ACNUC7421 zone)

EMBL: CP001622.PE1

CP001622.PE1         Location/Qualifiers
FT   CDS_pept        55..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rec:RHECIAT_CH0000397 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54313"
FT                   /db_xref="GOA:C6AY89"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY89"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS54313.1"
FT                   /translation="MQMNTMTTSGLDNGDAAPQAFGSIRLEAAEVKADMKQNVLFERVT
FT                   ARLKAQVGQDVYASWFARLKLHSVSKSVVRLSVPTTFLKSWINNRYLDLITGLFQAEDP
FT                   EILKIEVLVRTATRHGTKALDEAVAPEPAAPTQMRRPASAQPAGQAVQQAVSAVAAARP
FT                   ASFGSPLFGSPLDSRFTFDTFVEGSSNRVALAAAKTIAEAGQGAVRFNPLFIHSTVGLG
FT                   KTHLLQAVANAAVQNPRALRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIEFDA
FT                   PDYEMRLEILKRRLAVARLEDPSLEIPAELLQHVARNVTASGRELEGAFNQLVFRRSFE
FT                   PNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDTKLSHEVELLKRLINE"
     atgcagatga atacgatgac gacgagcggg ctcgacaatg gggatgcggc accgcaggcg        60
     ttcggctcca ttcgcctgga agcggcggaa gtaaaggcgg atatgaagca gaacgtattg       120
     tttgagcgcg tcaccgcgcg cttgaaggct caggtcggtc aggatgtcta cgccagctgg       180
     ttcgcccggc tgaagctgca ttcggtatcg aagagcgtcg ttcgcctttc ggtccccacg       240
     accttcctga agtcgtggat caacaatcgt tatctcgatc tcatcaccgg tctgttccag       300
     gccgaagatc cggaaattct gaaaatcgaa gtcctggtgc gtacggcgac gcgccacggc       360
     acgaaggcgc tcgatgaggc ggtcgcgccg gaaccagccg cccctacgca gatgcgccgc       420
     ccggcaagcg ctcagccggc cggtcaggcc gtccagcagg cggtttcggc cgttgccgcc       480
     gcaaggcccg caagcttcgg ctcgccgctc ttcggttcgc cgctcgatag ccgctttacc       540
     ttcgacacct tcgtcgaagg cagctcgaac cgggtagcac ttgcggctgc aaagacgatc       600
     gcggaagccg gtcagggcgc cgtgcgcttc aacccgctct tcatccattc gaccgtcggc       660
     ctcggcaaga cccacctgct gcaggctgtc gccaatgcgg cagtgcagaa ccccagggct       720
     ctgcgcgtcg tctatctgac ggccgaatat ttcatgtggc gtttcgccac cgcgatccgc       780
     gacaatgatg cgctgacgct gaaggattcg ctgcgcaaca tcgatctctt gatcatcgac       840
     gacatgcagt tcctgcaggg caagatgatc cagcatgaat tctgccatct cctcaacatg       900
     cttctcgaca gcgccaagca ggtcgtcgtt gccgccgacc gtgcgccctg ggagctggag       960
     tcgctcgacc cccgcgttcg ctcgcgcctc cagggcggcg tcgcgatcga attcgacgcg      1020
     ccggattacg agatgcgtct cgaaatcctc aagcgtcgcc ttgctgtcgc ccggctcgaa      1080
     gatccgtcgc tcgaaattcc ggccgagttg ctccagcatg tcgctcgcaa cgtcacggcc      1140
     agcggccgcg aacttgaagg cgctttcaac cagctggtct tccgccgctc cttcgagccg      1200
     aacctgtcga tcgaacgcgt cgacgaactg ctcgcccatc tggtcggctc cggcgaaccc      1260
     cgccgtgtgc gcatcgagga tatccagcgc atcgttgcaa gacactacaa tgtctcgcgc      1320
     caggaactgg tgtcgaaccg ccgcacccgc gtcatcgtca agccgcgcca gatcgccatg      1380
     tatctgtcga agacgctgac gccacgctcc ttcccggaga tcggccgccg tttcggcggg      1440
     cgtgatcaca cgaccgtgct gcacgccgtg cgcaagatcg aggaactaat ttcgggagac      1500
     accaagcttt cgcacgaagt cgagcttctg aagcgcctga tcaacgaata g               1551
//

If you have problems or comments...

PBIL Back to PBIL home page