(data stored in ACNUC7421 zone)

EMBL: CP001622.PE10

CP001622.PE10        Location/Qualifiers
FT   CDS_pept        9139..9564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0010"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH00367 molecular chaperone small heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54322"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY98"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACS54322.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIGADSG
FT                   APERLRITLAVAGFSEEELDVSIEENQLLIRGRQVEQGERDYLYRGIAARQFQRTFVLA
FT                   DGMQVLGAALKNGLLSVDLIRPEPARMVKKINISVSQ"
     atgagccgta ttaccccttt cgccagcccg ctgcttctgg gcttcgatgc catggaaaag        60
     acgttggagc gcatttccaa ggcgagcgac ggatatccgc cttataatat cgaacgcatc       120
     ggcgccgaca gcggcgcgcc ggaacgcctg cgcatcaccc ttgccgtggc cggtttcagc       180
     gaggaggagc tcgatgtctc cattgaggag aaccagcttc tgatccgcgg ccgccaggtc       240
     gaacagggcg agcgggatta tctttatcgc ggtatcgccg cccgtcagtt ccagcgtact       300
     ttcgttcttg ccgacggcat gcaggtgctg ggtgcggccc tgaagaacgg tctgctctcc       360
     gtcgatctaa ttcgtccgga acccgcgcgc atggtcaaga aaattaacat ttcggtctca       420
     cagtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page