(data stored in ACNUC7421 zone)

EMBL: CP001622.PE100

CP001622.PE100       Location/Qualifiers
FT   CDS_pept        97984..98202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54412"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ86"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH03206"
FT                   /protein_id="ACS54412.1"
FT                   /translation="MARVVVISVEGDDDLWVADLDAGTVVPLPSPKSGGLKAVTDLRAT
FT                   GAIVTKGVNLAVVVKSADAALSGHYDG"
     atggctagag ttgttgttat tagtgttgaa ggcgacgatg atctctgggt cgctgatctg        60
     gacgccggca cggtggtgcc tcttccgtct cccaagtcgg gcgggctgaa agcggtaacc       120
     gaccttcgag caaccggggc aatcgtgaca aagggcgtca atctggccgt ggtggtcaag       180
     tctgcggacg cggcattgtc gggccattat gatggctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page