(data stored in ACNUC7421 zone)

EMBL: CP001622.PE101

CP001622.PE101       Location/Qualifiers
FT   CDS_pept        complement(98295..98540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0102"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   rec:RHECIAT_CH0004115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54413"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ87"
FT                   /inference="protein motif:PFAM:PF06169"
FT                   /protein_id="ACS54413.1"
FT                   /translation="MQTIWKKPVTLALEGPDQWVVIQTTQAATWALVEDWPTEEGPALD
FT                   RACAVCADVMSGKRNREEARQAFIDAAIEAGIPIKE"
     atgcaaacca tttggaagaa gccggtgacg cttgcccttg aagggccgga tcagtgggtg        60
     gtgatccaga cgacccaagc cgcgacatgg gcgctggtcg aagactggcc gaccgaagag       120
     ggtcctgccc tggatagagc ctgtgcggtt tgcgccgatg tgatgtcggg caaacgaaac       180
     cgggaagagg cgcggcaggc gttcatcgac gctgcgatcg aagccggaat cccgattaag       240
     gaatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page