(data stored in ACNUC7421 zone)

EMBL: CP001622.PE102

CP001622.PE102       Location/Qualifiers
FT   CDS_pept        complement(98779..99300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54414"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ88"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A6246"
FT                   /protein_id="ACS54414.1"
FT                   /translation="MHNAKFIRHAAVSACVAFAAFQAGQVLADSANDKFFDAALCKPPY
FT                   TMTSAMKVYDVVEALAKPDTSSLGAAIYKLPNQIGRDGFKSTEIFFANNAVGVLVEGER
FT                   ADDLAVKYGLKPETSDLLGTSTKGYSRELPADLQPEPGMAGPGKVSIVARQGNALPGKT
FT                   LLACEFVQEF"
     atgcacaacg ccaaattcat tcgccacgct gccgtctccg catgcgtcgc ttttgcggca        60
     tttcaggccg ggcaggttct ggccgattcg gccaatgaca aattctttga cgcagccctt       120
     tgcaaaccac cctatacgat gacatcggca atgaaggtct atgatgtcgt ggaagctttg       180
     gccaagccgg acacgtcatc cttgggcgcg gcgatctaca aactcccgaa ccagataggc       240
     cgcgacggct ttaaatcgac cgagattttc tttgctaaca acgctgttgg cgtcttggtc       300
     gagggcgaac gcgccgacga tctggccgta aaatacggtt tgaagccgga gacctcggat       360
     ctactgggca catccaccaa gggctattcg cgcgagctgc cggcagatct gcagccggaa       420
     cccggaatgg ccgggcctgg aaaggtctcc atcgttgccc gccaaggcaa cgccttgcca       480
     ggaaagacat tgctggcgtg tgaattcgtt caggagttct ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page