(data stored in ACNUC7421 zone)

EMBL: CP001622.PE103

CP001622.PE103       Location/Qualifiers
FT   CDS_pept        99506..99688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54415"
FT                   /db_xref="GOA:C6AZ89"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ89"
FT                   /inference="similar to AA sequence:KEGG:AGR_L_287"
FT                   /protein_id="ACS54415.1"
FT                   /translation="MIAAYIDEIIMFCAGLWMTSVGFGYLPYPGKPASRPPLIRHFKWM
FT                   GPLLLAIAVVLAAAS"
     atgatcgcag cctatattga tgaaatcatc atgttttgcg ccggcctgtg gatgacatca        60
     gtcggctttg gttatctgcc atatccaggc aagccggcca gccggccacc gttgattcgc       120
     catttcaagt ggatgggtcc cttgctgctc gcgatcgcag tggttctggc ggctgcctca       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page