(data stored in ACNUC7421 zone)

EMBL: CP001622.PE104

CP001622.PE104       Location/Qualifiers
FT   CDS_pept        99716..100012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54416"
FT                   /db_xref="GOA:C6AZ90"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54416.1"
FT                   /translation="MTDMLACPSCGLDKTESIVHRGFYILRCAACGEAIVATSFMAMRD
FT                   SDHLCSAFIDPGPGKPPPPEMLVARGPLRQIATAISAAANDGTLIRLISEVKD"
     atgaccgata tgttggcctg cccgtcctgc ggattggaca aaacagaatc gatcgtccac        60
     cgcggtttct acattctccg atgcgccgcc tgcggcgaag cgattgtcgc cacatcattc       120
     atggcgatgc gcgactcgga tcacctgtgt tcggccttta tcgatccggg tcccggaaaa       180
     cctcctccgc cagagatgct cgtcgcgcgt ggaccgctcc ggcagatcgc aacggcaatt       240
     agcgctgcgg cgaatgatgg aactctgata cgtctgattt ctgaagtgaa agattga          297
//

If you have problems or comments...

PBIL Back to PBIL home page